BP918498
Clone id YMU001_000114_B12
Library
Length 482
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000114_B12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATTTGTCAAATTACAACCAACTATAAAAGGCAGAAAGGCTTACAATGGTCTACCAAGCTG
CTGTGAAGAGATCAGATTTCGGCACTTGCCTCGCAAGATGACGTAACACCATGAATAAAA
GCTTCACAAACTTCATATCTCTGAAGAATTGAAGAGCCCCTTTATGAATTCATTGGGCAC
AAAAATGTCATTTCCCTTTGCGATCATACATATGCATACATTCAAAATTTGCAATGAGCA
TCTCTGAAGGAGACAAGGTCATTTGAACCATTTCCAAGATGTGGATAGAGACTTTCCAGA
GACGTAATCAGCAATCCCCGCTTCACTACAACACCAGATCCCAGCAATCTTAATGCTCAT
CAAGGAGCATGTTTACTCTGTTTCCAATTTTCGCACTTTTATAATCCTCACGGAGCTCTA
TGAACCGTAACGCCTCCTTCCGAGAACCACGGAGGCTGCCATCTATGAGTGTGAATAAGC
TT
■■Homology search results ■■ -
sp_hit_id Q2QV94
Definition sp|Q2QV94|EXOC5_ORYSJ Exocyst complex component 5 OS=Oryza sativa subsp. japonica
Align length 42
Score (bit) 42.0
E-value 0.001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918498|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_B12.
(482 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q2QV94|EXOC5_ORYSJ Exocyst complex component 5 OS=Oryza sativ... 42 0.001
sp|Q8RVQ5|EXOC5_ARATH Exocyst complex component 5 OS=Arabidopsis... 41 0.003
sp|P58766|PLDZ1_ARATH Phospholipase D zeta OS=Arabidopsis thalia... 30 7.5
sp|Q971K8|Y1349_SULTO UPF0219 protein ST1349 OS=Sulfolobus tokod... 29 9.8

>sp|Q2QV94|EXOC5_ORYSJ Exocyst complex component 5 OS=Oryza sativa
subsp. japonica GN=SEC10 PE=2 SV=1
Length = 806

Score = 42.0 bits (97), Expect = 0.001
Identities = 21/42 (50%), Positives = 32/42 (76%)
Frame = -2

Query: 481 SLFTLIDGSLRGSRKEALRFIELREDYKSAKIGNRVNMLLDE 356
SL +L +G+ RK+ALRFI+LR+DYK+AKI + +N ++ E
Sbjct: 766 SLASLFEGT-PSIRKDALRFIQLRDDYKTAKIASMLNSIMAE 806


>sp|Q8RVQ5|EXOC5_ARATH Exocyst complex component 5 OS=Arabidopsis
thaliana GN=SEC10 PE=2 SV=2
Length = 825

Score = 40.8 bits (94), Expect = 0.003
Identities = 22/39 (56%), Positives = 29/39 (74%)
Frame = -2

Query: 481 SLFTLIDGSLRGSRKEALRFIELREDYKSAKIGNRVNML 365
SL TL +GS RK+A RFI+LREDYKSAK+ +++ L
Sbjct: 783 SLPTLFEGS-PSIRKDAQRFIQLREDYKSAKLATKLSSL 820


>sp|P58766|PLDZ1_ARATH Phospholipase D zeta OS=Arabidopsis thaliana
GN=PLDZETA PE=2 SV=1
Length = 820

Score = 29.6 bits (65), Expect = 7.5
Identities = 14/36 (38%), Positives = 18/36 (50%)
Frame = -1

Query: 218 YAYV*SQREMTFLCPMNS*RGSSILQRYEVCEAFIH 111
Y Y + + LCP N G SI+Q +EV F H
Sbjct: 303 YDYFKNTKVRCVLCPRNPDNGDSIVQGFEVATMFTH 338


>sp|Q971K8|Y1349_SULTO UPF0219 protein ST1349 OS=Sulfolobus tokodaii
GN=ST1349 PE=3 SV=1
Length = 348

Score = 29.3 bits (64), Expect = 9.8
Identities = 13/29 (44%), Positives = 19/29 (65%)
Frame = +2

Query: 317 PASLQHQIPAILMLIKEHVYSVSNFRTFI 403
PA H I A+ +L+KE YS+S+F F+
Sbjct: 205 PAYFAHIISAVQLLLKEGGYSISDFDYFV 233


tr_hit_id A9TT19
Definition tr|A9TT19|A9TT19_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 40
Score (bit) 52.0
E-value 1.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918498|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_B12.
(482 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TT19|A9TT19_PHYPA Predicted protein OS=Physcomitrella paten... 52 1e-05
tr|A9TWA3|A9TWA3_PHYPA Predicted protein OS=Physcomitrella paten... 47 6e-04
tr|A9RW79|A9RW79_PHYPA Predicted protein (Fragment) OS=Physcomit... 43 0.007
tr|Q0IP77|Q0IP77_ORYSJ Os12g0238100 protein OS=Oryza sativa subs... 42 0.015
tr|A3CG69|A3CG69_ORYSJ Putative uncharacterized protein OS=Oryza... 42 0.015
tr|A2ZJB7|A2ZJB7_ORYSI Putative uncharacterized protein OS=Oryza... 42 0.015
tr|A7PZJ4|A7PZJ4_VITVI Chromosome chr15 scaffold_40, whole genom... 39 0.098

>tr|A9TT19|A9TT19_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_197976 PE=4 SV=1
Length = 837

Score = 52.0 bits (123), Expect = 1e-05
Identities = 25/40 (62%), Positives = 33/40 (82%)
Frame = -2

Query: 481 SLFTLIDGSLRGSRKEALRFIELREDYKSAKIGNRVNMLL 362
SL TL+D SL+ +R EA+RFIELREDY+SAKI +R+ L+
Sbjct: 797 SLPTLVDSSLKQARAEAMRFIELREDYRSAKIASRLTALV 836


>tr|A9TWA3|A9TWA3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_172341 PE=4 SV=1
Length = 2209

Score = 46.6 bits (109), Expect = 6e-04
Identities = 21/42 (50%), Positives = 35/42 (83%)
Frame = -2

Query: 481 SLFTLIDGSLRGSRKEALRFIELREDYKSAKIGNRVNMLLDE 356
+L +LID SL+ +R++A+RF++LRED+K AK+ NR++ LD+
Sbjct: 879 TLPSLIDNSLKEAREDAVRFVKLREDFKLAKLENRISGWLDK 920


>tr|A9RW79|A9RW79_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_120365 PE=4 SV=1
Length = 781

Score = 43.1 bits (100), Expect = 0.007
Identities = 21/34 (61%), Positives = 26/34 (76%)
Frame = -2

Query: 481 SLFTLIDGSLRGSRKEALRFIELREDYKSAKIGN 380
SL TL++G LR R+EAL IELR+DYK AK+ N
Sbjct: 741 SLPTLMEGMLRDVREEALGLIELRDDYKKAKVAN 774


>tr|Q0IP77|Q0IP77_ORYSJ Os12g0238100 protein OS=Oryza sativa subsp.
japonica GN=Os12g0238100 PE=2 SV=1
Length = 806

Score = 42.0 bits (97), Expect = 0.015
Identities = 21/42 (50%), Positives = 32/42 (76%)
Frame = -2

Query: 481 SLFTLIDGSLRGSRKEALRFIELREDYKSAKIGNRVNMLLDE 356
SL +L +G+ RK+ALRFI+LR+DYK+AKI + +N ++ E
Sbjct: 766 SLASLFEGT-PSIRKDALRFIQLRDDYKTAKIASMLNSIMAE 806


>tr|A3CG69|A3CG69_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_034291 PE=4 SV=1
Length = 865

Score = 42.0 bits (97), Expect = 0.015
Identities = 21/42 (50%), Positives = 32/42 (76%)
Frame = -2

Query: 481 SLFTLIDGSLRGSRKEALRFIELREDYKSAKIGNRVNMLLDE 356
SL +L +G+ RK+ALRFI+LR+DYK+AKI + +N ++ E
Sbjct: 825 SLASLFEGT-PSIRKDALRFIQLRDDYKTAKIASMLNSIMAE 865


>tr|A2ZJB7|A2ZJB7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_37917 PE=4 SV=1
Length = 695

Score = 42.0 bits (97), Expect = 0.015
Identities = 21/42 (50%), Positives = 32/42 (76%)
Frame = -2

Query: 481 SLFTLIDGSLRGSRKEALRFIELREDYKSAKIGNRVNMLLDE 356
SL +L +G+ RK+ALRFI+LR+DYK+AKI + +N ++ E
Sbjct: 655 SLASLFEGT-PSIRKDALRFIQLRDDYKTAKIASMLNSIMAE 695


>tr|A7PZJ4|A7PZJ4_VITVI Chromosome chr15 scaffold_40, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00026901001
PE=4 SV=1
Length = 836

Score = 39.3 bits (90), Expect = 0.098
Identities = 20/39 (51%), Positives = 30/39 (76%)
Frame = -2

Query: 481 SLFTLIDGSLRGSRKEALRFIELREDYKSAKIGNRVNML 365
SL +L +G+ RK+A RFI+LREDYK+AK+ +R++ L
Sbjct: 795 SLSSLFEGT-PSIRKDAQRFIQLREDYKTAKLASRLSSL 832