BP918509
Clone id YMU001_000114_C12
Library
Length 582
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000114_C12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGCAAGGTGATATGCGATCATTTGGGGTATGGTGTGAAGACGGGACTACCTTACATTTGG
CATAGCAAAGCCAGCAACCCATTTGTGAACCTTAAAAAGGAATACAAGGGCATTTTTTGG
CAGGAGGAAATTATTCCGTTCTTCCAATCGGTGAAGCTACCAAAAGACTGCACGACAGTA
GAACAATGCTACATCGAGCTTTCCAAGCAGGTCACGGAGAAGCTGAGCGGTGTCGACCCG
TATTTTGGCAAATTGGGAGATGCCATGGTCACATGGATCGAAGCATGGGGCGAAGTGAAC
TCTTCGAAGTGAGAATGATCAGATTTTTAGGTTTTTGCCATTCTTCAAAATGCATTCACA
TTATGATTGCTTTATGAAGGAAGGCAGGAAATGAGATGGCAATTTTGTTGCTCGAAACAC
ATTTGAGGTTTTCTGGTTTCTTGGTAGATACTTTTCTTCTAGGTGGTCACATTATTTCAG
TGTGGAGTAAAGTGGAGATCCTTTCCCAGCGAAGCTCTGCGCTACTTGATTTATGCTTAT
TGATAGCATTGTACTATGCTGACCACAATGGAACTATTATGA
■■Homology search results ■■ -
sp_hit_id O04300
Definition sp|O04300|UPTG_PEA Alpha-1,4-glucan-protein synthase [UDP-forming] OS=Pisum sativum
Align length 104
Score (bit) 188.0
E-value 1.0e-47
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918509|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_C12.
(582 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O04300|UPTG_PEA Alpha-1,4-glucan-protein synthase [UDP-formin... 188 1e-47
sp|Q9SC19|UPTG1_SOLTU Alpha-1,4-glucan-protein synthase [UDP-for... 186 1e-46
sp|Q8RU27|UPTG2_SOLTU Alpha-1,4-glucan-protein synthase [UDP-for... 185 2e-46
sp|P80607|UPTG_MAIZE Alpha-1,4-glucan-protein synthase [UDP-form... 180 5e-45
sp|Q9P127|LUZP4_HUMAN Leucine zipper protein 4 OS=Homo sapiens G... 32 2.3
sp|Q03114|CDK5_RAT Cell division protein kinase 5 OS=Rattus norv... 31 3.9
sp|P49615|CDK5_MOUSE Cell division protein kinase 5 OS=Mus muscu... 31 3.9
sp|Q00535|CDK5_HUMAN Cell division protein kinase 5 OS=Homo sapi... 31 3.9
sp|Q02399|CDK5_BOVIN Cell division protein kinase 5 OS=Bos tauru... 31 3.9
sp|Q9VVX5|NESSY_DROME Transmembrane protein nessy OS=Drosophila ... 31 3.9
sp|O88986|KBL_MOUSE 2-amino-3-ketobutyrate coenzyme A ligase, mi... 30 6.7
sp|O75600|KBL_HUMAN 2-amino-3-ketobutyrate coenzyme A ligase, mi... 30 6.7
sp|Q0P5L8|KBL_BOVIN 2-amino-3-ketobutyrate coenzyme A ligase, mi... 30 6.7
sp|A0JMF1|CQ068_DANRE Uncharacterized protein C17orf68 homolog O... 30 8.7
sp|P04003|C4BPA_HUMAN C4b-binding protein alpha chain OS=Homo sa... 30 8.7

>sp|O04300|UPTG_PEA Alpha-1,4-glucan-protein synthase [UDP-forming]
OS=Pisum sativum GN=UPTG PE=1 SV=1
Length = 364

Score = 188 bits (478), Expect = 1e-47
Identities = 85/104 (81%), Positives = 94/104 (90%)
Frame = +1

Query: 4 KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSVKLPKDCTTVE 183
KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQ+ L KDCT+V+
Sbjct: 247 KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQAATLSKDCTSVQ 306

Query: 184 QCYIELSKQVTEKLSGVDPYFGKLGDAMVTWIEAWGEVNSSK*E 315
+CYIELSKQV EKL +DPYF KL DAMVTW+EAW E+N++K E
Sbjct: 307 KCYIELSKQVKEKLGTIDPYFIKLADAMVTWVEAWDEINNNKSE 350


>sp|Q9SC19|UPTG1_SOLTU Alpha-1,4-glucan-protein synthase
[UDP-forming] 1 OS=Solanum tuberosum GN=UPTG1 PE=1 SV=2
Length = 365

Score = 186 bits (471), Expect = 1e-46
Identities = 82/99 (82%), Positives = 91/99 (91%)
Frame = +1

Query: 4 KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSVKLPKDCTTVE 183
KVICDHLG G+KTGLPYIWHSKASNPFVNLKKEY GIFWQEEIIPFFQ+ LPK+CTTV+
Sbjct: 244 KVICDHLGLGIKTGLPYIWHSKASNPFVNLKKEYNGIFWQEEIIPFFQAATLPKECTTVQ 303

Query: 184 QCYIELSKQVTEKLSGVDPYFGKLGDAMVTWIEAWGEVN 300
QCY+ELSKQV +KLS +DPYF KLG+AMVTWIEAW E+N
Sbjct: 304 QCYLELSKQVKKKLSSIDPYFTKLGEAMVTWIEAWDELN 342


>sp|Q8RU27|UPTG2_SOLTU Alpha-1,4-glucan-protein synthase
[UDP-forming] 2 OS=Solanum tuberosum GN=UPTG2 PE=1 SV=1
Length = 366

Score = 185 bits (469), Expect = 2e-46
Identities = 84/99 (84%), Positives = 90/99 (90%)
Frame = +1

Query: 4 KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSVKLPKDCTTVE 183
KVICDHLG GVKTGLPYIWHSKASNPFVNLKKEYKGI+WQEEIIPF QS LPKDCT+V+
Sbjct: 248 KVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEYKGIYWQEEIIPFSQSATLPKDCTSVQ 307

Query: 184 QCYIELSKQVTEKLSGVDPYFGKLGDAMVTWIEAWGEVN 300
QCY+ELSKQV EKLS +DPYF KL DAMVTWIEAW E+N
Sbjct: 308 QCYLELSKQVKEKLSTIDPYFTKLADAMVTWIEAWDELN 346


>sp|P80607|UPTG_MAIZE Alpha-1,4-glucan-protein synthase
[UDP-forming] OS=Zea mays GN=UPTG PE=1 SV=2
Length = 364

Score = 180 bits (456), Expect = 5e-45
Identities = 82/101 (81%), Positives = 89/101 (88%)
Frame = +1

Query: 4 KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSVKLPKDCTTVE 183
KVICDHL GVKTGLPYIWHSKASNPFVNLKKEYKGIFWQE+IIPFFQ+V +PKDC TV+
Sbjct: 254 KVICDHLSLGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEDIIPFFQNVTIPKDCDTVQ 313

Query: 184 QCYIELSKQVTEKLSGVDPYFGKLGDAMVTWIEAWGEVNSS 306
+CYI LS QV EKL +DPYF KLGDAMVTWIEAW E+N S
Sbjct: 314 KCYIYLSGQVKEKLGTIDPYFVKLGDAMVTWIEAWDELNPS 354


>sp|Q9P127|LUZP4_HUMAN Leucine zipper protein 4 OS=Homo sapiens
GN=LUZP4 PE=2 SV=1
Length = 313

Score = 32.0 bits (71), Expect = 2.3
Identities = 17/46 (36%), Positives = 22/46 (47%)
Frame = +3

Query: 162 KRLHDSRTMLHRAFQAGHGEAERCRPVFWQIGRCHGHMDRSMGRSE 299
KR H H ++ HG++ER R HGH +RS G SE
Sbjct: 181 KRHHPQYERSHGQYKRSHGQSERSHG---HSERSHGHSERSHGHSE 223


>sp|Q03114|CDK5_RAT Cell division protein kinase 5 OS=Rattus
norvegicus GN=Cdk5 PE=1 SV=1
Length = 292

Score = 31.2 bits (69), Expect = 3.9
Identities = 13/33 (39%), Positives = 22/33 (66%)
Frame = +3

Query: 261 CHGHMDRSMGRSELFEVRMIRFLGFCHSSKCIH 359
C+G +D + +S LF+ +++ LGFCHS +H
Sbjct: 94 CNGDLDPEIVKSLLFQ--LLKGLGFCHSRNVLH 124


>sp|P49615|CDK5_MOUSE Cell division protein kinase 5 OS=Mus musculus
GN=Cdk5 PE=1 SV=1
Length = 292

Score = 31.2 bits (69), Expect = 3.9
Identities = 13/33 (39%), Positives = 22/33 (66%)
Frame = +3

Query: 261 CHGHMDRSMGRSELFEVRMIRFLGFCHSSKCIH 359
C+G +D + +S LF+ +++ LGFCHS +H
Sbjct: 94 CNGDLDPEIVKSFLFQ--LLKGLGFCHSRNVLH 124


>sp|Q00535|CDK5_HUMAN Cell division protein kinase 5 OS=Homo sapiens
GN=CDK5 PE=1 SV=3
Length = 292

Score = 31.2 bits (69), Expect = 3.9
Identities = 13/33 (39%), Positives = 22/33 (66%)
Frame = +3

Query: 261 CHGHMDRSMGRSELFEVRMIRFLGFCHSSKCIH 359
C+G +D + +S LF+ +++ LGFCHS +H
Sbjct: 94 CNGDLDPEIVKSFLFQ--LLKGLGFCHSRNVLH 124


>sp|Q02399|CDK5_BOVIN Cell division protein kinase 5 OS=Bos taurus
GN=CDK5 PE=1 SV=2
Length = 292

Score = 31.2 bits (69), Expect = 3.9
Identities = 13/33 (39%), Positives = 22/33 (66%)
Frame = +3

Query: 261 CHGHMDRSMGRSELFEVRMIRFLGFCHSSKCIH 359
C+G +D + +S LF+ +++ LGFCHS +H
Sbjct: 94 CNGDLDPEIVKSFLFQ--LLKGLGFCHSRNVLH 124


>sp|Q9VVX5|NESSY_DROME Transmembrane protein nessy OS=Drosophila
melanogaster GN=nes PE=1 SV=1
Length = 497

Score = 31.2 bits (69), Expect = 3.9
Identities = 13/48 (27%), Positives = 23/48 (47%)
Frame = +1

Query: 22 LGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSVKLPK 165
+ YG G +WH S ++ EY + +++I F+ V LP+
Sbjct: 345 ISYGAALGFLAVWHGYHSGYYMTFLMEYMVVSTEKQITRFYTKVVLPQ 392


tr_hit_id Q6IV07
Definition tr|Q6IV07|Q6IV07_SOLLC UDP-glucose:protein transglucosylase-like protein SlUPTG1 OS=Solanum lycopersicum
Align length 99
Score (bit) 188.0
E-value 2.0e-46
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918509|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_C12.
(582 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q6IV07|Q6IV07_SOLLC UDP-glucose:protein transglucosylase-like... 188 2e-46
tr|Q38M71|Q38M71_SOLTU UDP-glucose:protein transglucosylase-like... 188 2e-46
tr|O24548|O24548_VIGUN Type IIIa membrane protein cp-wap13 OS=Vi... 188 2e-46
tr|Q8VWN8|Q8VWN8_GOSHI Reversibly glycosylated polypeptide (GRP-... 185 1e-45
tr|Q1KV01|Q1KV01_9ROSI Putative uncharacterized protein OS=Cleom... 185 1e-45
tr|Q0PW29|Q0PW29_GOSHI GRP-like protein 2 OS=Gossypium hirsutum ... 185 1e-45
tr|A9NKS5|A9NKS5_PICSI Putative uncharacterized protein OS=Picea... 185 1e-45
tr|Q1KUU6|Q1KUU6_9ROSI Putative uncharacterized protein OS=Cleom... 184 2e-45
tr|A7PAD7|A7PAD7_VITVI Chromosome chr14 scaffold_9, whole genome... 184 2e-45
tr|A5BTI3|A5BTI3_VITVI Putative uncharacterized protein OS=Vitis... 184 2e-45
tr|Q5ZF83|Q5ZF83_PLAMJ Putative uncharacterized protein (Fragmen... 183 7e-45
tr|A9SX10|A9SX10_PHYPA Predicted protein OS=Physcomitrella paten... 183 7e-45
tr|Q1KUQ6|Q1KUQ6_9ROSI Putative uncharacterized protein OS=Cleom... 182 9e-45
tr|A9PD77|A9PD77_POPTR Putative uncharacterized protein OS=Popul... 182 1e-44
tr|A7P2D2|A7P2D2_VITVI Chromosome chr1 scaffold_5, whole genome ... 182 1e-44
tr|A9SX11|A9SX11_PHYPA Predicted protein OS=Physcomitrella paten... 181 2e-44
tr|A9SCU2|A9SCU2_PHYPA Predicted protein OS=Physcomitrella paten... 181 2e-44
tr|A9SCU1|A9SCU1_PHYPA Predicted protein OS=Physcomitrella paten... 181 2e-44
tr|A9SCU3|A9SCU3_PHYPA Predicted protein OS=Physcomitrella paten... 181 3e-44
tr|B4G039|B4G039_MAIZE Putative uncharacterized protein OS=Zea m... 180 6e-44
tr|B4FQX1|B4FQX1_MAIZE Putative uncharacterized protein OS=Zea m... 180 6e-44
tr|A7QHY1|A7QHY1_VITVI Chromosome chr17 scaffold_101, whole geno... 179 8e-44
tr|A5B109|A5B109_VITVI Putative uncharacterized protein OS=Vitis... 179 8e-44
tr|A7PHI0|A7PHI0_VITVI Chromosome chr17 scaffold_16, whole genom... 179 1e-43
tr|Q69F96|Q69F96_PHAVU Reversibly glycosylated protein OS=Phaseo... 177 3e-43
tr|Q9SRT9|Q9SRT9_ARATH Reversibly glycosylated polypeptide-1 (At... 176 1e-42
tr|Q9SR90|Q9SR90_ARATH Putative reversibly glycosylatable polype... 175 1e-42
tr|Q9LFW1|Q9LFW1_ARATH Reversibly glycosylated polypeptide-2 (At... 175 1e-42
tr|Q8LB19|Q8LB19_ARATH Reversibly glycosylated polypeptide-3 OS=... 175 1e-42
tr|Q8GWR6|Q8GWR6_ARATH Putative reversibly glycosylated polypept... 175 1e-42

>tr|Q6IV07|Q6IV07_SOLLC UDP-glucose:protein transglucosylase-like
protein SlUPTG1 OS=Solanum lycopersicum PE=2 SV=1
Length = 362

Score = 188 bits (477), Expect = 2e-46
Identities = 84/99 (84%), Positives = 91/99 (91%)
Frame = +1

Query: 4 KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSVKLPKDCTTVE 183
KVICDHLG G+KTGLPYIWHSKASNPFVNLKKEY GIFWQEEIIPFFQ+ LPK+CTTV+
Sbjct: 244 KVICDHLGLGIKTGLPYIWHSKASNPFVNLKKEYNGIFWQEEIIPFFQTATLPKECTTVQ 303

Query: 184 QCYIELSKQVTEKLSGVDPYFGKLGDAMVTWIEAWGEVN 300
QCY+ELSKQV EKLS +DPYF KLGDAMVTWIEAW E+N
Sbjct: 304 QCYLELSKQVKEKLSKIDPYFTKLGDAMVTWIEAWDELN 342


>tr|Q38M71|Q38M71_SOLTU UDP-glucose:protein transglucosylase-like
OS=Solanum tuberosum PE=2 SV=1
Length = 363

Score = 188 bits (477), Expect = 2e-46
Identities = 85/99 (85%), Positives = 91/99 (91%)
Frame = +1

Query: 4 KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSVKLPKDCTTVE 183
KVICDHLG GVKTGLPYIWHSKASNPFVNLKKEYKGI+WQEEIIPFFQS LPKDCT+V+
Sbjct: 248 KVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEYKGIYWQEEIIPFFQSATLPKDCTSVQ 307

Query: 184 QCYIELSKQVTEKLSGVDPYFGKLGDAMVTWIEAWGEVN 300
QCY+ELSKQV EKLS +DPYF KL DAMVTWIEAW E+N
Sbjct: 308 QCYLELSKQVKEKLSTIDPYFTKLADAMVTWIEAWDELN 346


>tr|O24548|O24548_VIGUN Type IIIa membrane protein cp-wap13 OS=Vigna
unguiculata PE=2 SV=1
Length = 346

Score = 188 bits (477), Expect = 2e-46
Identities = 85/101 (84%), Positives = 92/101 (91%)
Frame = +1

Query: 4 KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSVKLPKDCTTVE 183
KVICDHLG GVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQS LPK+CT+V+
Sbjct: 218 KVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSATLPKECTSVQ 277

Query: 184 QCYIELSKQVTEKLSGVDPYFGKLGDAMVTWIEAWGEVNSS 306
+CYIELSKQV EKL VDPYF KL DAMVTWIEAW E+N++
Sbjct: 278 KCYIELSKQVKEKLGAVDPYFNKLADAMVTWIEAWDELNNT 318


>tr|Q8VWN8|Q8VWN8_GOSHI Reversibly glycosylated polypeptide
(GRP-like protein 1) OS=Gossypium hirsutum GN=rgp1 PE=2
SV=1
Length = 359

Score = 185 bits (470), Expect = 1e-45
Identities = 84/101 (83%), Positives = 91/101 (90%)
Frame = +1

Query: 4 KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSVKLPKDCTTVE 183
KVICDHLG+GVKTGLPYIWHSKASNPFVNLKKEYKGI+WQEE+IPFFQSV LPKDCTTV+
Sbjct: 246 KVICDHLGWGVKTGLPYIWHSKASNPFVNLKKEYKGIYWQEELIPFFQSVALPKDCTTVQ 305

Query: 184 QCYIELSKQVTEKLSGVDPYFGKLGDAMVTWIEAWGEVNSS 306
+CYIE+SKQV KL VD YF KL DAMVTWIEAW E+N S
Sbjct: 306 KCYIEISKQVKAKLGKVDDYFNKLADAMVTWIEAWDELNPS 346


>tr|Q1KV01|Q1KV01_9ROSI Putative uncharacterized protein OS=Cleome
spinosa PE=4 SV=1
Length = 363

Score = 185 bits (470), Expect = 1e-45
Identities = 85/99 (85%), Positives = 92/99 (92%)
Frame = +1

Query: 4 KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSVKLPKDCTTVE 183
KVICDHLG GVKTGLPYI+HSKASNPFVNLKKEYKGIFWQEEIIPFFQ+VKLPK+CTTV+
Sbjct: 254 KVICDHLGLGVKTGLPYIYHSKASNPFVNLKKEYKGIFWQEEIIPFFQNVKLPKECTTVQ 313

Query: 184 QCYIELSKQVTEKLSGVDPYFGKLGDAMVTWIEAWGEVN 300
QCYIELSK V EKLS +DPYF KL +AMVTWIEAW E+N
Sbjct: 314 QCYIELSKLVKEKLSTIDPYFDKLSEAMVTWIEAWDELN 352


>tr|Q0PW29|Q0PW29_GOSHI GRP-like protein 2 OS=Gossypium hirsutum
GN=GRPL2 PE=2 SV=1
Length = 359

Score = 185 bits (470), Expect = 1e-45
Identities = 84/101 (83%), Positives = 91/101 (90%)
Frame = +1

Query: 4 KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSVKLPKDCTTVE 183
KVICDHLG+GVKTGLPYIWHSKASNPFVNLKKEYKGI+WQEE+IPFFQSV LPKDCTTV+
Sbjct: 246 KVICDHLGWGVKTGLPYIWHSKASNPFVNLKKEYKGIYWQEELIPFFQSVALPKDCTTVQ 305

Query: 184 QCYIELSKQVTEKLSGVDPYFGKLGDAMVTWIEAWGEVNSS 306
+CYIE+SKQV KL VD YF KL DAMVTWIEAW E+N S
Sbjct: 306 KCYIEISKQVKAKLGKVDDYFNKLADAMVTWIEAWDELNPS 346


>tr|A9NKS5|A9NKS5_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 363

Score = 185 bits (470), Expect = 1e-45
Identities = 85/99 (85%), Positives = 89/99 (89%)
Frame = +1

Query: 4 KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSVKLPKDCTTVE 183
KVICDHLG GVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQS LPK+CT+V+
Sbjct: 246 KVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSATLPKECTSVQ 305

Query: 184 QCYIELSKQVTEKLSGVDPYFGKLGDAMVTWIEAWGEVN 300
QCYIELSKQV E L VDPYF KL DAMVTWIEAW E+N
Sbjct: 306 QCYIELSKQVKESLGKVDPYFQKLADAMVTWIEAWDELN 344


>tr|Q1KUU6|Q1KUU6_9ROSI Putative uncharacterized protein OS=Cleome
spinosa PE=4 SV=1
Length = 364

Score = 184 bits (468), Expect = 2e-45
Identities = 83/99 (83%), Positives = 92/99 (92%)
Frame = +1

Query: 4 KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSVKLPKDCTTVE 183
KVICDHLG GVKTGLPYI+HSKASNPFVNLKKEYKGIFWQEEIIPFFQ+VKLPK+CTTV+
Sbjct: 254 KVICDHLGLGVKTGLPYIYHSKASNPFVNLKKEYKGIFWQEEIIPFFQNVKLPKECTTVQ 313

Query: 184 QCYIELSKQVTEKLSGVDPYFGKLGDAMVTWIEAWGEVN 300
QCY+ELSK V EKLS +DPYF KL +AMVTWI+AW E+N
Sbjct: 314 QCYMELSKMVKEKLSSIDPYFDKLSEAMVTWIQAWDELN 352


>tr|A7PAD7|A7PAD7_VITVI Chromosome chr14 scaffold_9, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038072001
PE=4 SV=1
Length = 359

Score = 184 bits (468), Expect = 2e-45
Identities = 84/99 (84%), Positives = 89/99 (89%)
Frame = +1

Query: 4 KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSVKLPKDCTTVE 183
KV CDHLG GVKTGLPYIWHSKASNPFVNLKKEY GIFWQEEIIPFFQSV LPKDCTTV+
Sbjct: 248 KVTCDHLGLGVKTGLPYIWHSKASNPFVNLKKEYNGIFWQEEIIPFFQSVSLPKDCTTVQ 307

Query: 184 QCYIELSKQVTEKLSGVDPYFGKLGDAMVTWIEAWGEVN 300
+CY+EL+K V EKL VDPYF KLGDAMVTWIEAW E+N
Sbjct: 308 KCYVELAKLVKEKLGKVDPYFVKLGDAMVTWIEAWDELN 346


>tr|A5BTI3|A5BTI3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_036160 PE=4 SV=1
Length = 386

Score = 184 bits (468), Expect = 2e-45
Identities = 84/99 (84%), Positives = 89/99 (89%)
Frame = +1

Query: 4 KVICDHLGYGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSVKLPKDCTTVE 183
KV CDHLG GVKTGLPYIWHSKASNPFVNLKKEY GIFWQEEIIPFFQSV LPKDCTTV+
Sbjct: 248 KVTCDHLGLGVKTGLPYIWHSKASNPFVNLKKEYNGIFWQEEIIPFFQSVSLPKDCTTVQ 307

Query: 184 QCYIELSKQVTEKLSGVDPYFGKLGDAMVTWIEAWGEVN 300
+CY+EL+K V EKL VDPYF KLGDAMVTWIEAW E+N
Sbjct: 308 KCYVELAKLVKEKLGKVDPYFVKLGDAMVTWIEAWDELN 346