BP918510
Clone id YMU001_000114_D01
Library
Length 573
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000114_D01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTAGCTGTGTCATTCATACACTACCTTTATCGATAACGTGGCACCACACTTCCACA
TCTGATGCAGTTCGAGTATGGAAAGGCGTGTGAGGTGATACAGAGAATTTTTTGAGAGCG
CCTATCCAAACGAAACATAATCATTACCATCTTCAAAAGCACAGGATAAGGCTCTGATAC
CAAATGTTTGGAAAAGATGGTGAGCATGATGACAAGGAGAGTAGACACGGATGTAGTCTG
CAACAATACTAGTACTACAAAGAAATCCCCGGTCAAGCTCTGCTTTACAAATAAATGGAA
ACGATCAAATCAAGGTCTTATGCCTATTGGGCAGCAGCCTTGAATGGAAGGCAGCACCCC
CTTCCTAATGTAGCTTTACAAAATTGCTTTAAGCTTGGCCTCCTGCCAGCCTCGTTTACA
ATACAGCTGCATTTTTTTAGAAAACAGCCACTGCAAATATTGTGTGACCTAAAGCGGACC
CAATTAGGGCCTATCTGACATGCTCCAGCTGTACATGCAGGGGCACAACAGCAGCCCAAC
TAGAGGACTCTGTTAATACTTCCTTTGATAAAG
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918510|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_D01.
(573 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id B1IJE8
Definition tr|B1IJE8|B1IJE8_CLOBK Restriction endonuclease family protein OS=Clostridium botulinum (strain Okra / Type B1)
Align length 69
Score (bit) 33.5
E-value 8.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918510|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_D01.
(573 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B1IJE8|B1IJE8_CLOBK Restriction endonuclease family protein O... 33 8.6
tr|B0WCV2|B0WCV2_CULQU Putative uncharacterized protein OS=Culex... 33 8.6

>tr|B1IJE8|B1IJE8_CLOBK Restriction endonuclease family protein
OS=Clostridium botulinum (strain Okra / Type B1)
GN=CLD_3301 PE=4 SV=1
Length = 741

Score = 33.5 bits (75), Expect = 8.6
Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 2/69 (2%)
Frame = -3

Query: 259 CSTSIVADYIRVYSPCHHAHHLFQTFGIRALSCAFEDGNDYVSFG*AL--SKNSLYHLTR 86
C + + YI+ Y C H+ +LF+ F RAL A E+G Y++F + S+NS Y R
Sbjct: 392 CWKNSLEYYIKNYGQCVHSPNLFEYFIRRALEKAKEEG--YLAFVVPINFSRNSQYIQLR 449

Query: 85 LSILELHQM 59
IL +++
Sbjct: 450 NEILNKYEI 458


>tr|B0WCV2|B0WCV2_CULQU Putative uncharacterized protein OS=Culex
quinquefasciatus GN=CpipJ_CPIJ005055 PE=4 SV=1
Length = 218

Score = 33.5 bits (75), Expect = 8.6
Identities = 15/47 (31%), Positives = 21/47 (44%)
Frame = -2

Query: 488 PNWVRFRSHNICSGCFLKKCSCIVNEAGRRPSLKQFCKATLGRGCCL 348
P+W + H ICSGC + C + C+ LGRG C+
Sbjct: 165 PSWQCYHGHLICSGCRSRSSKCPI------------CRVLLGRGRCI 199