BP918537
Clone id YMU001_000114_F11
Library
Length 309
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000114_F11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCAGGAGCACAAGTAAACTTATGTCAATCATGTGGAATCTGTGATGGGCTTCAACTATTG
GCATCTGTTGCCTAACGTGAGCAGATCATATTAAAGGCTTGTGCATGGAATTGCATTCAT
GAACTGTAGTCAAATGATCTTTCTCTGGCTCCAATGCTTTAAAATGAGCTTGTTGGAGAA
GATTGGATCACTGGTGACATACCTTCGAATCCCGCAGAAAACTCCCACCCAAATTCTTGA
GAGTTTTCCAAATATTTTCTAAAAATGGTGAGTTTTCCTTAGAAACCATTGACCAAAGGG
TTAGATCCT
■■Homology search results ■■ -
sp_hit_id Q08199
Definition sp|Q08199|SIL1_YEAST Nucleotide exchange factor SIL1 OS=Saccharomyces cerevisiae
Align length 33
Score (bit) 29.3
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918537|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_F11.
(309 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q08199|SIL1_YEAST Nucleotide exchange factor SIL1 OS=Saccharo... 29 6.4
sp|P35568|IRS1_HUMAN Insulin receptor substrate 1 OS=Homo sapien... 29 8.4

>sp|Q08199|SIL1_YEAST Nucleotide exchange factor SIL1
OS=Saccharomyces cerevisiae GN=SIL1 PE=1 SV=1
Length = 421

Score = 29.3 bits (64), Expect = 6.4
Identities = 15/33 (45%), Positives = 20/33 (60%)
Frame = -2

Query: 227 WEFSAGFEGMSPVIQSSPTSSF*SIGARERSFD 129
+EFS+ F+ M +I S+PT S I E SFD
Sbjct: 124 YEFSSDFKEMRNIIDSNPTLSSQDIARLEDSFD 156


>sp|P35568|IRS1_HUMAN Insulin receptor substrate 1 OS=Homo sapiens
GN=IRS1 PE=1 SV=1
Length = 1242

Score = 28.9 bits (63), Expect = 8.4
Identities = 17/64 (26%), Positives = 27/64 (42%)
Frame = -3

Query: 286 VSKENSPFLENIWKTLKNLGGSFLRDSKVCHQ*SNLLQQAHFKALEPEKDHLTTVHECNS 107
V + +S EN+W LGG+ +K+C L ++ L+ KD EC
Sbjct: 1138 VKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTP 1197

Query: 106 MHKP 95
+P
Sbjct: 1198 EPQP 1201


tr_hit_id A4IDN1
Definition tr|A4IDN1|A4IDN1_LEIIN Putative uncharacterized protein OS=Leishmania infantum
Align length 48
Score (bit) 35.0
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918537|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_F11.
(309 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A4IDN1|A4IDN1_LEIIN Putative uncharacterized protein OS=Leish... 35 1.9
tr|A8P8S4|A8P8S4_COPC7 Predicted protein OS=Coprinopsis cinerea ... 33 7.2
tr|A4HPW9|A4HPW9_LEIBR Putative uncharacterized protein OS=Leish... 33 9.3

>tr|A4IDN1|A4IDN1_LEIIN Putative uncharacterized protein
OS=Leishmania infantum GN=LinJ36.5120 PE=4 SV=1
Length = 1054

Score = 35.0 bits (79), Expect = 1.9
Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
Frame = +1

Query: 10 QVNLCQSCGICDGL-QLLASVA*REQIILKACAWNCIHEL*SNDLSLA 150
Q+ LC S + D + QL A+ A R ++ C W+ IH ++L LA
Sbjct: 514 QIPLCASAAVADEVNQLFATAALRTDTLVDLCVWSAIHNTREDELELA 561


>tr|A8P8S4|A8P8S4_COPC7 Predicted protein OS=Coprinopsis cinerea
(strain Okayama-7 / 130 / FGSC 9003) GN=CC1G_10619 PE=4
SV=1
Length = 252

Score = 33.1 bits (74), Expect = 7.2
Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 4/80 (5%)
Frame = +2

Query: 32 VESVMGFNYWHLLPNVSRSY*RLVHGIAFMNCSQMIFLWLQCFKMSLLEKIGSLVTYLRI 211
VE+V FNY+H P+ + LV + F+ + MI + + FK+++++ G + RI
Sbjct: 30 VETVQSFNYYHSFPDDTWYLQWLVGILWFLELAHMILVAAEIFKITIIQ-YGDPESLRRI 88

Query: 212 PQKT----PTQILESFPNIF 259
P P+ ++ S ++F
Sbjct: 89 PYLVGAIFPSTLVTSLTHLF 108


>tr|A4HPW9|A4HPW9_LEIBR Putative uncharacterized protein
OS=Leishmania braziliensis GN=LbrM35_V2.4760 PE=4 SV=1
Length = 1050

Score = 32.7 bits (73), Expect = 9.3
Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
Frame = +1

Query: 10 QVNLCQSCG-ICDGLQLLASVA*REQIILKACAWNCIHEL*SNDLSLA 150
Q+ LC S CD LLA+ A + + ++ C WN IH +D A
Sbjct: 510 QIPLCSSAARSCDVNPLLATAALQTETLVDLCVWNAIHNTQEDDREAA 557