BP918547
Clone id YMU001_000114_G09
Library
Length 519
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000114_G09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCACCTTTACATGCAAGCGCAGTGGATGCAAATGGGCAACCGCAAAATATGCCATTGTAT
GAGTCTCCCCGTCGGACCTCACCAGCTGTTGCGTCACCGCATAGAGGAACGGAGCACCCA
TTTCCATCCTTTCATAAGAGCCCATCTGCGATGTCCCCCAAGTGTTTGAAACTGTCAAAG
CAAACTAAATCTAGTCCTTCTCGAGGGGTCTCTGGGAATACTATGCATGGTGATAGCAAT
GGAGATGCAAAGGTTCTTAATGAAGTGCAAGCCGTAAAAGAAATACCTGACCCAGAACTG
AAAACAGCTAAGCCAATTGGTCGCGGGGCATTCAAGTCGGCATTCAATAGAAGAAGCTTT
TCAGGACCTTTGAGAAGCATGTTCGAGAATACTATGGCAGGTTCCCCTGCAGTTCCCAGC
TACATGGCAGCCACCCAATCAGCAAAGGCAAAAGCTCGATCACAGAGCAATCCCAAGATG
CGGCCAGAGCCAGTGGACGAGAAAGGGTCACCGACATCC
■■Homology search results ■■ -
sp_hit_id Q8L4D8
Definition sp|Q8L4D8|IQD31_ARATH Protein IQ-DOMAIN 31 OS=Arabidopsis thaliana
Align length 197
Score (bit) 47.8
E-value 3.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918547|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_G09.
(519 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8L4D8|IQD31_ARATH Protein IQ-DOMAIN 31 OS=Arabidopsis thalia... 48 3e-05
sp|Q8LPG9|IQD14_ARATH Protein IQ-DOMAIN 14 OS=Arabidopsis thalia... 45 2e-04
sp|Q8BTI8|SRRM2_MOUSE Serine/arginine repetitive matrix protein ... 39 0.011
sp|Q9FXI5|IQD32_ARATH Protein IQ-DOMAIN 32 OS=Arabidopsis thalia... 39 0.015
sp|Q8NDI1|EHBP1_HUMAN EH domain-binding protein 1 OS=Homo sapien... 36 0.096
sp|Q5ZMJ9|SRRM1_CHICK Serine/arginine repetitive matrix protein ... 35 0.21
sp|P22856|VL96_IRV1 L96 protein OS=Tipula iridescent virus GN=L9... 34 0.36
sp|Q923E4|SIRT1_MOUSE NAD-dependent deacetylase sirtuin-1 OS=Mus... 34 0.36
sp|Q62504|MINT_MOUSE Msx2-interacting protein OS=Mus musculus GN... 33 1.1
sp|Q69ZW3|EHBP1_MOUSE EH domain-binding protein 1 OS=Mus musculu... 33 1.1
sp|P21657|DAL81_YEAST Transcriptional activator protein DAL81 OS... 33 1.1
sp|Q7SCC1|DCL2_NEUCR Dicer-like protein 2 OS=Neurospora crassa G... 32 1.4
sp|Q17RH7|TPRXL_HUMAN Putative protein TPRXL OS=Homo sapiens GN=... 32 1.4
sp|O74653|POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe G... 32 1.4
sp|Q64332|SYN2_MOUSE Synapsin-2 OS=Mus musculus GN=Syn2 PE=1 SV=2 32 1.8
sp|A2AKB4|FRPD1_MOUSE FERM and PDZ domain-containing protein 1 O... 32 1.8
sp|Q9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein ... 32 2.4
sp|O60107|SNX41_SCHPO Sorting nexin-41 OS=Schizosaccharomyces po... 32 2.4
sp|Q6ZQF7|JADE2_MOUSE Protein Jade-2 OS=Mus musculus GN=Phf15 PE... 32 2.4
sp|Q6GQT0|CC14A_MOUSE Dual specificity protein phosphatase CDC14... 32 2.4
sp|Q32L09|CS066_BOVIN UPF0515 protein C19orf66 homolog OS=Bos ta... 31 3.0
sp|Q12267|SMC4_YEAST Structural maintenance of chromosomes prote... 31 3.1
sp|P35831|PTN12_MOUSE Tyrosine-protein phosphatase non-receptor ... 31 3.1
sp|Q867T7|NCFA_DICDI NADPH oxidase activator OS=Dictyostelium di... 31 3.1
sp|A7E305|K0913_BOVIN Zinc finger SWIM domain-containing protein... 31 3.1
sp|Q9HF61|BUD3_ASHGO Bud site selection protein 3 homolog OS=Ash... 31 3.1
sp|Q8CC35|SYNPO_MOUSE Synaptopodin OS=Mus musculus GN=Synpo PE=1... 31 4.0
sp|Q3UHH1|K0913_MOUSE Zinc finger SWIM domain-containing protein... 31 4.0
sp|Q07134|H1O_CHITH Histone H1, orphon OS=Chironomus thummi thum... 31 4.0
sp|Q09933|DIS1_SCHPO Phosphoprotein p93 OS=Schizosaccharomyces p... 31 4.0

>sp|Q8L4D8|IQD31_ARATH Protein IQ-DOMAIN 31 OS=Arabidopsis thaliana
GN=IQD31 PE=1 SV=1
Length = 587

Score = 47.8 bits (112), Expect = 3e-05
Identities = 55/197 (27%), Positives = 81/197 (41%), Gaps = 29/197 (14%)
Frame = +1

Query: 7 LHASAVDANGQPQNMPLYESPRRTSPAVASPHRGTEHP----FPSFHKSPSAMSPKCLKL 174
+H V+++ QPQ P E V P G E +P H++ C +
Sbjct: 342 VHNPVVESSIQPQRSPRKE--------VEKPKLGVEKTRESSYPLVHETAEEPVNVCDEK 393

Query: 175 SKQTKSS-PSRGVSGNTMHGDSNG--------DAKVLNEVQA-----VKEIPDPEL---- 300
KQ S P V M + G D+ ++N++ + V+E P E
Sbjct: 394 KKQEISEQPEEEVHALEMEVHTPGPLETNEALDSSLVNQIDSNEKAMVEEKPSMEKDTKE 453

Query: 301 -KTAKPIGRGAFKSAFNRRSFS-GPLRSMFENTMAG-----SPAVPSYMAATQSAKAKAR 459
KT KP + N++S G S E + SP++PSYM AT+SAKAK R
Sbjct: 454 EKTPKPNNKENSAGKENQKSRKKGSATSKTEREESNGHHETSPSIPSYMQATKSAKAKLR 513

Query: 460 SQSNPKMRPEPVDEKGS 510
Q +PK + EK +
Sbjct: 514 LQGSPKSAEQDGTEKAT 530


>sp|Q8LPG9|IQD14_ARATH Protein IQ-DOMAIN 14 OS=Arabidopsis thaliana
GN=IQD14 PE=1 SV=1
Length = 668

Score = 45.4 bits (106), Expect = 2e-04
Identities = 41/142 (28%), Positives = 60/142 (42%), Gaps = 3/142 (2%)
Frame = +1

Query: 88 VASPHRGTEHPFPSFHKSPSAMSPKCLKLSKQTKSSPSRGVSGNTMHGDSNGDAKVLNEV 267
+ASP P F +PS + P L S + + + D++ D
Sbjct: 474 LASPAPSYSQPQRDFRLTPSRLCPSPLSQSSKQ----------HHIRLDNHFDTSTPRSS 523

Query: 268 QAVKEIPDPELKTAKPIGRGAFKSAFNR-RSFSGPLRSMFENTMAGSPAVPSYMAATQSA 444
++ P ++PI G + + R R P + ++++ P PSYMA T SA
Sbjct: 524 RSTFHTP------SRPIHTGTSRYSRGRLRGQDSPFKD--DDSLTSCPPFPSYMAPTVSA 575

Query: 445 KAKARSQSNPKMR--PEPVDEK 504
KAK R SNPK R PV EK
Sbjct: 576 KAKVRPNSNPKERVMGTPVSEK 597


>sp|Q8BTI8|SRRM2_MOUSE Serine/arginine repetitive matrix protein 2
OS=Mus musculus GN=Srrm2 PE=1 SV=2
Length = 2703

Score = 39.3 bits (90), Expect = 0.011
Identities = 39/159 (24%), Positives = 70/159 (44%)
Frame = +1

Query: 16 SAVDANGQPQNMPLYESPRRTSPAVASPHRGTEHPFPSFHKSPSAMSPKCLKLSKQTKSS 195
S D++ +P+ +P ++PR S + +SP R + P +S S S + L++ +
Sbjct: 1434 SECDSSPEPKALP--QTPRARSHSPSSPERNNKSVTPQRERSGSESSVEQKNLARTSPGQ 1491

Query: 196 PSRGVSGNTMHGDSNGDAKVLNEVQAVKEIPDPELKTAKPIGRGAFKSAFNRRSFSGPLR 375
SR S + G + + +E + PD + KT P+ +RS SG
Sbjct: 1492 RSRSGSSQELDGKPSASPQERSESDS---SPDSKPKTRTPL---------RQRSHSG--- 1536

Query: 376 SMFENTMAGSPAVPSYMAATQSAKAKARSQSNPKMRPEP 492
SP V S ++ + +RS S+P+M+ +P
Sbjct: 1537 --------SSPEVDS---KSRHSPRLSRSGSSPEMKDKP 1564


>sp|Q9FXI5|IQD32_ARATH Protein IQ-DOMAIN 32 OS=Arabidopsis thaliana
GN=IQD32 PE=1 SV=2
Length = 794

Score = 38.9 bits (89), Expect = 0.015
Identities = 31/142 (21%), Positives = 61/142 (42%), Gaps = 6/142 (4%)
Frame = +1

Query: 82 PAVASP----HRGTEHPFP-SFHKSPSAMSPKCLKLSKQTKSSP-SRGVSGNTMHGDSNG 243
P +++P R + P ++ S A++P + S+ T +S S V + +G
Sbjct: 607 PVISTPDSKKRRAEDESGPQAYALSEGALTPMTITESQATPASQASSSVKARKGKSEKSG 666

Query: 244 DAKVLNEVQAVKEIPDPELKTAKPIGRGAFKSAFNRRSFSGPLRSMFENTMAGSPAVPSY 423
++ + + P E+ T + + K + R S + G ++P +
Sbjct: 667 SSQKRKVSKKITSSPKQEIGTGEATEQEEGKEQKSGRRTSFGYDQEARESSGGKNSLPRF 726

Query: 424 MAATQSAKAKARSQSNPKMRPE 489
M TQSAKAK + ++P+ P+
Sbjct: 727 MQPTQSAKAKVQEHNSPRSSPD 748


>sp|Q8NDI1|EHBP1_HUMAN EH domain-binding protein 1 OS=Homo sapiens
GN=EHBP1 PE=1 SV=3
Length = 1231

Score = 36.2 bits (82), Expect = 0.096
Identities = 19/55 (34%), Positives = 24/55 (43%)
Frame = +1

Query: 109 TEHPFPSFHKSPSAMSPKCLKLSKQTKSSPSRGVSGNTMHGDSNGDAKVLNEVQA 273
+EH P H SPS SP C + T+ S+ SG T D G + QA
Sbjct: 626 SEHQTPDDHLSPSTASPYCRRTKSDTEPQKSQQSSGRTSGSDDPGICSNTDSTQA 680


>sp|Q5ZMJ9|SRRM1_CHICK Serine/arginine repetitive matrix protein 1
OS=Gallus gallus GN=SRRM1 PE=2 SV=1
Length = 888

Score = 35.0 bits (79), Expect = 0.21
Identities = 39/153 (25%), Positives = 60/153 (39%), Gaps = 8/153 (5%)
Frame = +1

Query: 70 RRTSPAVASPHRGTEHPFPSFHKSPSAMSPKCLKLSKQTKSSPSRGVSGNTMHGDSNGDA 249
RR SP+ S R + P P SP+A SK K SP S +
Sbjct: 616 RRASPSPQSKRRVSHSPPPKQRSSPAAKRRSPSISSKHRKGSP-----------PSRSNR 664

Query: 250 KVLNEVQAVKEIPDPELKTA------KPIGRGAFKSAFNRRSFSGPLRSMFENTMAGSPA 411
+ + Q ++ P P + + P+ RGA S R+S S R + ++ +P
Sbjct: 665 ETRSPPQNKRDSPSPRPRASHTSSSPPPLRRGASASPQRRQSPSPSTRPI--RRVSRTPE 722

Query: 412 VPSYMAATQSAKAKAR--SQSNPKMRPEPVDEK 504
A+T S ++ R S + PEP +K
Sbjct: 723 PKKTKASTPSPRSARRVSSSRSASGSPEPAPKK 755


>sp|P22856|VL96_IRV1 L96 protein OS=Tipula iridescent virus GN=L96
PE=4 SV=1
Length = 867

Score = 34.3 bits (77), Expect = 0.36
Identities = 40/153 (26%), Positives = 59/153 (38%), Gaps = 1/153 (0%)
Frame = +1

Query: 61 ESPRRTSPAVASPHRGTEHPFPSFHKSPSAMSPKCLKLSKQTKSSPSRGVSGNTMHGDSN 240
+SPRR+ PA R PS KSPSA + SPS G++
Sbjct: 427 KSPRRSPPASVRRSRT-----PSVPKSPSA---------RPRSKSPSVRAEITDDEGETP 472

Query: 241 GDAKVLNEVQAVKEIPDPELKTAKPIGRGAFKSAFNRRSFSGPLRSMFENTMAGSPAV-P 417
+ + P ++ P R SA RS S +RS + SP+V P
Sbjct: 473 PSSVRPKSPSVRPKSPSVRPRSKSPSVRPKSPSA-RPRSKSPSVRSKSPSVRPKSPSVRP 531

Query: 418 SYMAATQSAKAKARSQSNPKMRPEPVDEKGSPT 516
+ +K+ + +P +RP P D SP+
Sbjct: 532 KSPSVRPRSKSPSVRPKSPSVRPPPPDPSNSPS 564


>sp|Q923E4|SIRT1_MOUSE NAD-dependent deacetylase sirtuin-1 OS=Mus
musculus GN=Sirt1 PE=1 SV=2
Length = 737

Score = 34.3 bits (77), Expect = 0.36
Identities = 27/103 (26%), Positives = 48/103 (46%), Gaps = 4/103 (3%)
Frame = +1

Query: 1 APLHASAVDANGQPQNMPLYESPRRTSPAVA-SPHRGTEHPFPSFH--KSPSAMSPKCL- 168
+P A+A++A QP + PL + PRR P + SP + P+ ++ SA +P L
Sbjct: 14 SPSAAAAMEAASQPADEPLRKRPRRDGPGLGRSPGEPSAAVAPAAAGCEAASAAAPAALW 73

Query: 169 KLSKQTKSSPSRGVSGNTMHGDSNGDAKVLNEVQAVKEIPDPE 297
+ + +S R + GD + + + E +A + D E
Sbjct: 74 REAAGAAASAEREAPATAVAGDGDNGSGLRREPRAADDFDDDE 116


>sp|Q62504|MINT_MOUSE Msx2-interacting protein OS=Mus musculus GN=Spen
PE=1 SV=2
Length = 3644

Score = 32.7 bits (73), Expect = 1.1
Identities = 40/165 (24%), Positives = 62/165 (37%), Gaps = 11/165 (6%)
Frame = +1

Query: 25 DANGQPQNMPLYESPRRTSPAVAS-PHRGTEHPFPSFHKSPSAM----------SPKCLK 171
DA+G+P+N + +P P + P G E P H++ S + +P+
Sbjct: 2240 DASGEPEN---FSAPPSVPPGSQTHPREGME---PGLHEAESGILETGTATESSAPQVSA 2293

Query: 172 LSKQTKSSPSRGVSGNTMHGDSNGDAKVLNEVQAVKEIPDPELKTAKPIGRGAFKSAFNR 351
L S+ ++ GN+ GDS +AK KT + R A K
Sbjct: 2294 LDPPEGSADTKETRGNS--GDSVQEAKGSKAEVTPPRKDKGRQKTTRRRKRNANKKVV-- 2349

Query: 352 RSFSGPLRSMFENTMAGSPAVPSYMAATQSAKAKARSQSNPKMRP 486
+ + S E T + SPA AAT A + + P P
Sbjct: 2350 -AITETRASEAEQTQSESPAAEEATAATPEAPQEEKPSEKPPSPP 2393


>sp|Q69ZW3|EHBP1_MOUSE EH domain-binding protein 1 OS=Mus musculus
GN=Ehbp1 PE=2 SV=2
Length = 1231

Score = 32.7 bits (73), Expect = 1.1
Identities = 19/65 (29%), Positives = 27/65 (41%)
Frame = +1

Query: 109 TEHPFPSFHKSPSAMSPKCLKLSKQTKSSPSRGVSGNTMHGDSNGDAKVLNEVQAVKEIP 288
+EH P H SPS SP + T+ S+ S T D G + + QA+ +
Sbjct: 636 SEHQTPDDHLSPSTASPYYRRTKSDTEPQKSQQSSARTSGSDDPGLSSSTDSAQALASLG 695

Query: 289 DPELK 303
LK
Sbjct: 696 KKRLK 700


tr_hit_id A9TQC9
Definition tr|A9TQC9|A9TQC9_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 149
Score (bit) 57.8
E-value 3.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918547|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_G09.
(519 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TQC9|A9TQC9_PHYPA Predicted protein (Fragment) OS=Physcomit... 58 3e-07
tr|Q6L5I6|Q6L5I6_ORYSJ Os05g0535900 protein OS=Oryza sativa subs... 56 1e-06
tr|A9TYE9|A9TYE9_PHYPA Predicted protein (Fragment) OS=Physcomit... 56 1e-06
tr|A3B689|A3B689_ORYSJ Putative uncharacterized protein OS=Oryza... 56 1e-06
tr|B8B097|B8B097_ORYSI Putative uncharacterized protein OS=Oryza... 54 4e-06
tr|A9SAC4|A9SAC4_PHYPA Predicted protein (Fragment) OS=Physcomit... 53 1e-05
tr|B8LKS1|B8LKS1_PICSI Putative uncharacterized protein OS=Picea... 52 2e-05
tr|A9TSG9|A9TSG9_PHYPA Predicted protein (Fragment) OS=Physcomit... 52 2e-05
tr|Q0WPW7|Q0WPW7_ARATH Putative uncharacterized protein At4g0082... 51 3e-05
tr|O23094|O23094_ARATH A_TM018A10.13 protein (AT4g00820 protein)... 50 5e-05
tr|B6U6R2|B6U6R2_MAIZE Calmodulin binding protein OS=Zea mays PE... 50 5e-05
tr|A5BSR2|A5BSR2_VITVI Putative uncharacterized protein OS=Vitis... 50 5e-05
tr|A9NV67|A9NV67_PICSI Putative uncharacterized protein OS=Picea... 50 9e-05
tr|B7FLN4|B7FLN4_MEDTR Putative uncharacterized protein OS=Medic... 49 1e-04
tr|A7Q2T6|A7Q2T6_VITVI Chromosome chr1 scaffold_46, whole genome... 49 1e-04
tr|A7Q5Y5|A7Q5Y5_VITVI Chromosome chr14 scaffold_54, whole genom... 47 4e-04
tr|A5C5B0|A5C5B0_VITVI Putative uncharacterized protein OS=Vitis... 47 4e-04
tr|A5BAX7|A5BAX7_VITVI Putative uncharacterized protein OS=Vitis... 47 6e-04
tr|B6T984|B6T984_MAIZE Calmodulin binding protein OS=Zea mays PE... 47 7e-04
tr|Q8RXR4|Q8RXR4_ARATH Putative uncharacterized protein At4g1475... 46 0.001
tr|O23331|O23331_ARATH Putative uncharacterized protein dl3415w ... 46 0.001
tr|B7FFB4|B7FFB4_MEDTR Putative uncharacterized protein (Fragmen... 46 0.001
tr|B1N669|B1N669_SOLLC SUN (Putative calmodulin binding protein ... 46 0.001
tr|A9P856|A9P856_POPTR Putative uncharacterized protein OS=Popul... 46 0.001
tr|B3H4F6|B3H4F6_ARATH Uncharacterized protein At2g43680.1 OS=Ar... 45 0.002
tr|A7PSZ4|A7PSZ4_VITVI Chromosome chr8 scaffold_29, whole genome... 45 0.002
tr|Q6YXT2|Q6YXT2_ORYSJ Os08g0115200 protein OS=Oryza sativa subs... 45 0.002
tr|B2CXQ9|B2CXQ9_CARAS At2g43680-like protein (Fragment) OS=Card... 45 0.002
tr|A7QI65|A7QI65_VITVI Chromosome chr17 scaffold_101, whole geno... 45 0.002
tr|A5C5E8|A5C5E8_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002

>tr|A9TQC9|A9TQC9_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_148970 PE=4 SV=1
Length = 391

Score = 57.8 bits (138), Expect = 3e-07
Identities = 43/149 (28%), Positives = 66/149 (44%)
Frame = +1

Query: 73 RTSPAVASPHRGTEHPFPSFHKSPSAMSPKCLKLSKQTKSSPSRGVSGNTMHGDSNGDAK 252
R PA+++P+ G H H SPS M + + +P + S
Sbjct: 176 RNGPAMSAPY-GNGHGHSHSHHSPSTMQRTSSQGAFHPPVTPPSAYKSTPVLVRSASPRT 234

Query: 253 VLNEVQAVKEIPDPELKTAKPIGRGAFKSAFNRRSFSGPLRSMFENTMAGSPAVPSYMAA 432
+ + TA+ + G R S +G + S + ++A P+VP+YM A
Sbjct: 235 SIRREDIEEGGSTVSAATARSMASGPRYGT--RYSHAGSVMSRDDESLASFPSVPNYMQA 292

Query: 433 TQSAKAKARSQSNPKMRPEPVDEKGSPTS 519
TQSAKAK RS S PK RP +++ S +S
Sbjct: 293 TQSAKAKVRSHSTPKQRPGTLEKDNSWSS 321


>tr|Q6L5I6|Q6L5I6_ORYSJ Os05g0535900 protein OS=Oryza sativa subsp.
japonica GN=OJ1741_B01.8 PE=4 SV=1
Length = 574

Score = 55.8 bits (133), Expect = 1e-06
Identities = 47/165 (28%), Positives = 76/165 (46%), Gaps = 16/165 (9%)
Frame = +1

Query: 61 ESPRRTS------PAVASPHRG-------TEHPFPSFHKSPSAMSPKCL---KLSKQTKS 192
E P+RT+ P + P G T+ P P S + K+++ T +
Sbjct: 365 EKPQRTAEEVPNYPEIQEPQNGNLLENAKTDILVPDLQPEPEVPSYQVETEEKVAELTVA 424

Query: 193 SPSRGVSGNTMHGDSNGDAKVLNEVQAVKEIPDPELKTAKPIGRGAFKSAFNRRSFSGPL 372
P+ V + N + ++N+++ + +P+ + KS+ R SFS
Sbjct: 425 DPT--VETMPLQDIHNEENALVNDME--------QRSKEEPLSTESLKSSKRRSSFSTKT 474

Query: 373 RSMFENTMAGSPAVPSYMAATQSAKAKARSQSNPKMRPEPVDEKG 507
EN SPAVPSYMAATQSAKAK R Q++P++ + ++ G
Sbjct: 475 EYP-ENGSKNSPAVPSYMAATQSAKAKLRGQNSPRLSSDSAEKNG 518


>tr|A9TYE9|A9TYE9_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_152658 PE=4 SV=1
Length = 403

Score = 55.8 bits (133), Expect = 1e-06
Identities = 27/47 (57%), Positives = 34/47 (72%)
Frame = +1

Query: 346 NRRSFSGPLRSMFENTMAGSPAVPSYMAATQSAKAKARSQSNPKMRP 486
NR S +G + S + ++A SP+VP+YM ATQSAKAK RS S PK RP
Sbjct: 276 NRYSNAGSVMSRDDKSLASSPSVPNYMQATQSAKAKVRSHSTPKQRP 322


>tr|A3B689|A3B689_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_018561 PE=4 SV=1
Length = 567

Score = 55.8 bits (133), Expect = 1e-06
Identities = 47/165 (28%), Positives = 76/165 (46%), Gaps = 16/165 (9%)
Frame = +1

Query: 61 ESPRRTS------PAVASPHRG-------TEHPFPSFHKSPSAMSPKCL---KLSKQTKS 192
E P+RT+ P + P G T+ P P S + K+++ T +
Sbjct: 365 EKPQRTAEEVPNYPEIQEPQNGNLLENAKTDILVPDLQPEPEVPSYQVETEEKVAELTVA 424

Query: 193 SPSRGVSGNTMHGDSNGDAKVLNEVQAVKEIPDPELKTAKPIGRGAFKSAFNRRSFSGPL 372
P+ V + N + ++N+++ + +P+ + KS+ R SFS
Sbjct: 425 DPT--VETMPLQDIHNEENALVNDME--------QRSKEEPLSTESLKSSKRRSSFSTKT 474

Query: 373 RSMFENTMAGSPAVPSYMAATQSAKAKARSQSNPKMRPEPVDEKG 507
EN SPAVPSYMAATQSAKAK R Q++P++ + ++ G
Sbjct: 475 EYP-ENGSKNSPAVPSYMAATQSAKAKLRGQNSPRLSSDSAEKNG 518


>tr|B8B097|B8B097_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_20773 PE=4 SV=1
Length = 805

Score = 54.3 bits (129), Expect = 4e-06
Identities = 47/165 (28%), Positives = 75/165 (45%), Gaps = 16/165 (9%)
Frame = +1

Query: 61 ESPRRTS------PAVASPHRG-------TEHPFPSFHKSPSAMSPKCL---KLSKQTKS 192
E P+RT+ P + P G T+ P P S + K+++ T +
Sbjct: 378 EKPQRTAEEVPNYPEIQEPQNGNLLENAKTDILVPDLQPEPEVPSYQVETEEKVAELTVA 437

Query: 193 SPSRGVSGNTMHGDSNGDAKVLNEVQAVKEIPDPELKTAKPIGRGAFKSAFNRRSFSGPL 372
P+ V + N + ++N+++ + +P+ + KS+ R SFS
Sbjct: 438 DPA--VETMPLQDIHNEENALVNDME--------QRSKEEPLSTESLKSSKRRSSFSTKT 487

Query: 373 RSMFENTMAGSPAVPSYMAATQSAKAKARSQSNPKMRPEPVDEKG 507
EN SPAVPSYMAATQSAKAK R Q+ P++ + ++ G
Sbjct: 488 EYP-ENGSKNSPAVPSYMAATQSAKAKLRGQNLPRLSSDSAEKNG 531


>tr|A9SAC4|A9SAC4_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_42864 PE=4 SV=1
Length = 338

Score = 52.8 bits (125), Expect = 1e-05
Identities = 27/54 (50%), Positives = 37/54 (68%)
Frame = +1

Query: 349 RRSFSGPLRSMFENTMAGSPAVPSYMAATQSAKAKARSQSNPKMRPEPVDEKGS 510
R S +G +R + ++A SP+VP+YM ATQSA+AK RS S PK RP ++ GS
Sbjct: 273 RYSQAGSIRD--DESLASSPSVPNYMQATQSARAKVRSHSQPKQRPMTPEKDGS 324


>tr|B8LKS1|B8LKS1_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 672

Score = 51.6 bits (122), Expect = 2e-05
Identities = 30/60 (50%), Positives = 37/60 (61%)
Frame = +1

Query: 334 KSAFNRRSFSGPLRSMFENTMAGSPAVPSYMAATQSAKAKARSQSNPKMRPEPVDEKGSP 513
KS R SF E+ GSP++PSYMAAT+SAKAK R S P+ P+ V EKG+P
Sbjct: 559 KSTRRRSSFGSVKTEHPEHASQGSPSIPSYMAATESAKAKLRGHS-PRSSPD-VQEKGTP 616


>tr|A9TSG9|A9TSG9_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_31884 PE=4 SV=1
Length = 360

Score = 51.6 bits (122), Expect = 2e-05
Identities = 25/52 (48%), Positives = 36/52 (69%)
Frame = +1

Query: 355 SFSGPLRSMFENTMAGSPAVPSYMAATQSAKAKARSQSNPKMRPEPVDEKGS 510
S +G +R + ++A P+VP+YM ATQSA+AK RS S PK RP +++ GS
Sbjct: 297 SHAGSIRD--DESLASCPSVPNYMQATQSARAKVRSHSQPKQRPGTLEKDGS 346


>tr|Q0WPW7|Q0WPW7_ARATH Putative uncharacterized protein At4g00820
OS=Arabidopsis thaliana GN=At4g00820 PE=2 SV=1
Length = 534

Score = 51.2 bits (121), Expect = 3e-05
Identities = 45/157 (28%), Positives = 69/157 (43%), Gaps = 12/157 (7%)
Frame = +1

Query: 70 RRTSPAVASPHRGTEHPFPSFHKSPSAMSPKCLKLSKQTKSSPSRGVSGNTMHGDSNGDA 249
+R P + T P+ + S + SP Q SSPSR H S+
Sbjct: 315 QRVPPVYKTVEIDTSQPYLTHGNSRTGASPS----RSQRPSSPSRTSHHYQQHNFSSATP 370

Query: 250 KVLNEVQAVKEIPDPELKTAKPIGRGAFKSAFNRRSFSGPLRSMFE------------NT 393
K P ++++A P + +SA+N S + LRS + T
Sbjct: 371 S------PAKSRPI-QIRSASPRIQRDDRSAYNYTSNTPSLRSNYSFTARSGYSVCTTTT 423

Query: 394 MAGSPAVPSYMAATQSAKAKARSQSNPKMRPEPVDEK 504
A + A+P+YMA T+SAKA+ RSQS P+ RP +++
Sbjct: 424 TATNAALPNYMAITESAKARIRSQSAPRQRPSTPEKE 460


>tr|O23094|O23094_ARATH A_TM018A10.13 protein (AT4g00820 protein)
OS=Arabidopsis thaliana GN=A_TM018A10.13 PE=2 SV=1
Length = 496

Score = 50.4 bits (119), Expect = 5e-05
Identities = 45/157 (28%), Positives = 69/157 (43%), Gaps = 12/157 (7%)
Frame = +1

Query: 70 RRTSPAVASPHRGTEHPFPSFHKSPSAMSPKCLKLSKQTKSSPSRGVSGNTMHGDSNGDA 249
+R P + T P+ + S + SP Q SSPSR H S+
Sbjct: 277 QRVPPVYKTVEIDTSQPYLTRGNSRTGASPS----RSQRPSSPSRTSHHYQQHNFSSATP 332

Query: 250 KVLNEVQAVKEIPDPELKTAKPIGRGAFKSAFNRRSFSGPLRSMFE------------NT 393
K P ++++A P + +SA+N S + LRS + T
Sbjct: 333 S------PAKSRPI-QIRSASPRIQRDDRSAYNYTSNTPSLRSNYSFTARSGYSVCTTTT 385

Query: 394 MAGSPAVPSYMAATQSAKAKARSQSNPKMRPEPVDEK 504
A + A+P+YMA T+SAKA+ RSQS P+ RP +++
Sbjct: 386 TATNAALPNYMAITESAKARIRSQSAPRQRPSTPEKE 422