BP918555
Clone id YMU001_000114_H06
Library
Length 368
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000114_H06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGAGAAAAACGGTTTCCATTTCATTTTGGAGCATCATAACAACAGTATGAAGATGGCAAG
CCGTGCAATTTACTGGCAGGATGAGCCAATGTTACTCTCATATCAAAAACATCAATTATA
ACGGAGCCATTGCGATAGCAAAAAATCATCGTAAGCTCCCCACGTACTTCTTCCTGTAAG
TCCCTTCAATATCTACAGCTTCCACTTTCTGTGACCCTGTGACTACAATTGGCCATCGAC
ATCAAGCAATTGCTAGCATTAAGCTGACACAAAAGAATATACAAGTAAAAATGTCATCTG
TTGAAACGTGCTATGCGTGCTCTTCTCATCTCCTCCACAGACATTGAAGCAGATGATAAT
GGTGGGGC
■■Homology search results ■■ -
sp_hit_id P57372
Definition sp|P57372|SUHB_BUCAI Inositol-1-monophosphatase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum
Align length 46
Score (bit) 29.3
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918555|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_H06.
(368 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P57372|SUHB_BUCAI Inositol-1-monophosphatase OS=Buchnera aphi... 29 6.4

>sp|P57372|SUHB_BUCAI Inositol-1-monophosphatase OS=Buchnera
aphidicola subsp. Acyrthosiphon pisum GN=suhB PE=3 SV=1
Length = 266

Score = 29.3 bits (64), Expect = 6.4
Identities = 14/46 (30%), Positives = 24/46 (52%)
Frame = -1

Query: 182 DLQEEVRGELTMIFCYRNGSVIIDVFDMRVTLAHPASKLHGLPSSY 45
DL V+G+ + + YR I+ + +P++K+H L SSY
Sbjct: 124 DLFTAVKGQGSQLNGYRTRCSAINTLNYSTVAVNPSNKIHNLTSSY 169


tr_hit_id B6WMC0
Definition tr|B6WMC0|B6WMC0_9BACE Putative uncharacterized protein OS=Bacteroides finegoldii DSM 17565
Align length 61
Score (bit) 36.6
E-value 0.64
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918555|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_H06.
(368 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6WMC0|B6WMC0_9BACE Putative uncharacterized protein OS=Bacte... 37 0.64
tr|A5ZF12|A5ZF12_9BACE Putative uncharacterized protein OS=Bacte... 33 7.1
tr|A4A3Q2|A4A3Q2_9GAMM Putative uncharacterized protein OS=Congr... 33 7.1

>tr|B6WMC0|B6WMC0_9BACE Putative uncharacterized protein
OS=Bacteroides finegoldii DSM 17565 GN=BACFIN_03681 PE=4
SV=1
Length = 785

Score = 36.6 bits (83), Expect = 0.64
Identities = 25/61 (40%), Positives = 32/61 (52%), Gaps = 3/61 (4%)
Frame = -1

Query: 287 YLYILL-CQLNASNCL--MSMANCSHRVTESGSCRY*RDLQEEVRGELTMIFCYRNGSVI 117
Y YIL QL+ SN L ++ N SH V+ S SCRY D V E + RNG +I
Sbjct: 418 YYYILYEAQLDRSNTLRLLTSENASHEVSISPSCRYLVDSYSTVSQEPVNVVRNRNGKII 477

Query: 116 I 114
+
Sbjct: 478 M 478


>tr|A5ZF12|A5ZF12_9BACE Putative uncharacterized protein
OS=Bacteroides caccae ATCC 43185 GN=BACCAC_01476 PE=4
SV=1
Length = 785

Score = 33.1 bits (74), Expect = 7.1
Identities = 24/61 (39%), Positives = 30/61 (49%), Gaps = 3/61 (4%)
Frame = -1

Query: 287 YLYILL-CQLNASNCL--MSMANCSHRVTESGSCRY*RDLQEEVRGELTMIFCYRNGSVI 117
Y YIL L+ N L ++ N SH V+ S SCRY D V E + RNG VI
Sbjct: 418 YYYILYEAHLDRPNALRLLTPENASHEVSISPSCRYLVDSYSTVSQEPVNVVRNRNGKVI 477

Query: 116 I 114
+
Sbjct: 478 M 478


>tr|A4A3Q2|A4A3Q2_9GAMM Putative uncharacterized protein
OS=Congregibacter litoralis KT71 GN=KT71_16686 PE=4 SV=1
Length = 493

Score = 33.1 bits (74), Expect = 7.1
Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
Frame = -1

Query: 179 LQEEVRGELTMIFCYR--NGSVIIDVFDMRVTLAHPASKLHGLPSSY 45
L + G LT++F + NG +++D+ D+R TL H A L +SY
Sbjct: 131 LNDTQEGVLTLVFQFADDNGLLMLDLADLRTTLQHLADNRQSLGTSY 177