BP918571
Clone id YMU001_000115_A12
Library
Length 475
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000115_A12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GGGTCACGAACTTCATAATCGGCCTCTACTTCTTGAGTGCGGTGACCAAGTTTGGTATAA
GTACTGTCTATCAAGGATTTGCAGCTGTCTGTCTTGTGGCAGCCATTTACATATCACAGA
ATGTGGTGGAAACCAAGGGAAAATCTCTTGAAGAAATTGAGTTGGAGCTTGCTCCTGCAG
TTTGAGCTCTGGTTCTTCATCACTAATGTTCCAAGTCAAGGTTGTGAGGTACTGTCGTTT
GGCAAAAGTCCCTTACGCTGCTTTGATGAGTGTACCTTTGAGGCGTCTGTTTTTCCATGA
GCCTGAGAAGCTGTGGGTCATAATATTGACCACAACAGAGAAGGGCTTGTTTGTTTATAA
TCTGTGCCTTTTGAGATGAGGTGCCAAGAATCAGCTGGCATGACCGAAAAAATGCTATAT
GTATTGAGTCTCAGACTTTGCAGTCTTGGGTAGCCATTTAATAATAGTCAGTGTC
■■Homology search results ■■ -
sp_hit_id Q56ZZ7
Definition sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana
Align length 48
Score (bit) 76.3
E-value 7.0e-14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918571|Adiantum capillus-veneris mRNA, clone:
YMU001_000115_A12.
(475 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabido... 76 7e-14
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 O... 54 5e-07
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 O... 50 5e-06
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 O... 46 1e-04
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucos... 40 0.004
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose ... 39 0.015
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucos... 39 0.015
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucos... 37 0.044
sp|P46333|CSBC_BACSU Probable metabolite transport protein csbC ... 36 0.076
sp|P54723|YFIG_BACSU Putative metabolite transport protein yfiG ... 35 0.17
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated gluco... 35 0.17
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose ... 33 0.64
sp|Q863Y9|GTR5_HORSE Solute carrier family 2, facilitated glucos... 33 0.84
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose ... 33 0.84
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated gluco... 31 2.4
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidop... 31 3.2
sp|Q82ST5|LFTR_NITEU Leucyl/phenylalanyl-tRNA--protein transfera... 30 4.2
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabid... 30 5.4
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabid... 30 5.4
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucos... 30 5.4
sp|Q08598|CBL_KLEAE HTH-type transcriptional regulator cbl OS=Kl... 30 5.4
sp|Q2IP38|LFTR_ANADE Leucyl/phenylalanyl-tRNA--protein transfera... 30 5.5
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucos... 30 7.1
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucos... 30 7.1
sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated glucos... 30 7.1
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis th... 29 9.3
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose ... 29 9.3
sp|P56951|MDM2_HORSE E3 ubiquitin-protein ligase Mdm2 OS=Equus c... 29 9.4
sp|Q7YRZ8|MDM2_FELCA E3 ubiquitin-protein ligase Mdm2 OS=Felis s... 29 9.4
sp|P56950|MDM2_CANFA E3 ubiquitin-protein ligase Mdm2 OS=Canis f... 29 9.4

>sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4
OS=Arabidopsis thaliana GN=At5g16150 PE=2 SV=2
Length = 546

Score = 76.3 bits (186), Expect = 7e-14
Identities = 34/48 (70%), Positives = 43/48 (89%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
++NF+IGLYFLS VTKFGIS+VY GFA VC++A +YI+ NVVETKG+S
Sbjct: 487 ISNFVIGLYFLSVVTKFGISSVYLGFAGVCVLAVLYIAGNVVETKGRS 534


>sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1
OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2
Length = 524

Score = 53.5 bits (127), Expect = 5e-07
Identities = 24/48 (50%), Positives = 34/48 (70%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
V+NF++GL+FL V K+G+ TVY F +V L+AA + VETKG+S
Sbjct: 462 VSNFLVGLFFLDLVEKYGVGTVYASFGSVSLLAAAFSHLFTVETKGRS 509


>sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2
OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1
Length = 493

Score = 50.1 bits (118), Expect = 5e-06
Identities = 21/48 (43%), Positives = 32/48 (66%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
V NF +GL FL + K G +Y F+ CL+A +++ +NV+ETKGK+
Sbjct: 434 VINFFVGLLFLRLLEKLGPRLLYSMFSTFCLMAVMFVKRNVIETKGKT 481


>sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3
OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2
Length = 495

Score = 45.8 bits (107), Expect = 1e-04
Identities = 22/48 (45%), Positives = 30/48 (62%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
V NF +GL FL + + G + F C+VA I++ +NVVETKGKS
Sbjct: 435 VINFFVGLLFLRMLEQLGSVLLNAIFGFFCVVAVIFVQKNVVETKGKS 482


>sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose
transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2
Length = 507

Score = 40.4 bits (93), Expect = 0.004
Identities = 19/48 (39%), Positives = 30/48 (62%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
+T F++ FL V+ FG+ + FAA+CLV+ ++ V ETKG+S
Sbjct: 443 LTAFVLTKSFLPVVSTFGLQVPFFFFAAICLVSLVFTGCCVPETKGRS 490


>sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose
transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2
SV=1
Length = 512

Score = 38.5 bits (88), Expect = 0.015
Identities = 22/48 (45%), Positives = 29/48 (60%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
+TNFIIG F S G + + FA +CL+ AIYI + ETKGK+
Sbjct: 427 LTNFIIGFLFPSIQEAIGAYS-FIIFAGICLLTAIYIYVVIPETKGKT 473


>sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose
transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2
Length = 512

Score = 38.5 bits (88), Expect = 0.015
Identities = 22/48 (45%), Positives = 29/48 (60%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
+TNFIIG F S G + + FA +CL+ AIYI + ETKGK+
Sbjct: 427 LTNFIIGFLFPSIQEAIGAYS-FIIFAGICLLTAIYIYVVIPETKGKT 473


>sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose
transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1
Length = 513

Score = 37.0 bits (84), Expect = 0.044
Identities = 20/48 (41%), Positives = 29/48 (60%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
+TNFI+GL F S G + + FA VC++ A YI + ETKG++
Sbjct: 428 LTNFIVGLTFPSIQVAIGAYS-FLVFAGVCILTAAYIYVVIPETKGRT 474


>sp|P46333|CSBC_BACSU Probable metabolite transport protein csbC
OS=Bacillus subtilis GN=csbC PE=1 SV=3
Length = 461

Score = 36.2 bits (82), Expect = 0.076
Identities = 17/46 (36%), Positives = 27/46 (58%)
Frame = +3

Query: 9 NFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
N I+ L F ++ GI+ V+ F+ +CL++ + V ETKGKS
Sbjct: 388 NLIVSLVFPLMLSAMGIAWVFMVFSVICLLSFFFAFYMVPETKGKS 433


>sp|P54723|YFIG_BACSU Putative metabolite transport protein yfiG
OS=Bacillus subtilis GN=yfiG PE=3 SV=1
Length = 482

Score = 35.0 bits (79), Expect = 0.17
Identities = 16/46 (34%), Positives = 28/46 (60%)
Frame = +3

Query: 9 NFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
NF+IG F + G+S + F A+ ++A +++ + V ETKG+S
Sbjct: 410 NFLIGFTFPILLNHIGMSATFFIFVAMNILAILFVKKYVPETKGRS 455


tr_hit_id Q93WT7
Definition tr|Q93WT7|Q93WT7_OLEEU Hexose transporter pGlT OS=Olea europaea
Align length 48
Score (bit) 79.0
E-value 1.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918571|Adiantum capillus-veneris mRNA, clone:
YMU001_000115_A12.
(475 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q93WT7|Q93WT7_OLEEU Hexose transporter pGlT OS=Olea europaea ... 79 1e-13
tr|O48537|O48537_PRUAR Putative sugar transporter OS=Prunus arme... 78 3e-13
tr|Q539E7|Q539E7_VITVI Plastid hexose transporter OS=Vitis vinif... 77 3e-13
tr|A7PAT0|A7PAT0_VITVI Chromosome chr14 scaffold_9, whole genome... 77 3e-13
tr|Q9LLE1|Q9LLE1_TOBAC Hexose transporter (Fragment) OS=Nicotian... 76 7e-13
tr|Q9LLE0|Q9LLE0_SOLTU Hexose transporter (Fragment) OS=Solanum ... 76 7e-13
tr|B8LMN4|B8LMN4_PICSI Putative uncharacterized protein OS=Picea... 76 7e-13
tr|Q84XS8|Q84XS8_BRARP Putative sugar transporter (Fragment) OS=... 76 1e-12
tr|Q9FXY8|Q9FXY8_MESCR Putative glucose translocator OS=Mesembry... 75 2e-12
tr|Q5ZCN2|Q5ZCN2_ORYSJ Putative hexose transporter OS=Oryza sati... 75 2e-12
tr|Q0JQX6|Q0JQX6_ORYSJ Os01g0133400 protein (Fragment) OS=Oryza ... 75 2e-12
tr|B8AD38|B8AD38_ORYSI Putative uncharacterized protein OS=Oryza... 75 2e-12
tr|A2ZNY2|A2ZNY2_ORYSJ Putative uncharacterized protein OS=Oryza... 75 2e-12
tr|Q9LLE2|Q9LLE2_SPIOL Hexose transporter OS=Spinacia oleracea P... 75 2e-12
tr|B8A2T1|B8A2T1_MAIZE Putative uncharacterized protein OS=Zea m... 74 5e-12
tr|B3GS76|B3GS76_MAIZE Hexose transporter OS=Zea mays PE=2 SV=1 74 5e-12
tr|Q9LLD9|Q9LLD9_MAIZE Hexose transporter (Fragment) OS=Zea mays... 73 6e-12
tr|B4FUK4|B4FUK4_MAIZE Putative uncharacterized protein OS=Zea m... 73 6e-12
tr|A9PF39|A9PF39_POPTR Putative uncharacterized protein OS=Popul... 70 4e-11
tr|A9SWL4|A9SWL4_PHYPA Predicted protein OS=Physcomitrella paten... 64 3e-09
tr|A9RDA5|A9RDA5_PHYPA Predicted protein OS=Physcomitrella paten... 62 2e-08
tr|A9SNX2|A9SNX2_PHYPA Predicted protein OS=Physcomitrella paten... 58 2e-07
tr|A9REK0|A9REK0_PHYPA Predicted protein OS=Physcomitrella paten... 58 2e-07
tr|A7PX84|A7PX84_VITVI Chromosome chr12 scaffold_36, whole genom... 54 5e-06
tr|Q6H454|Q6H454_ORYSJ Putative hexose transporter OS=Oryza sati... 53 7e-06
tr|Q67V03|Q67V03_ORYSJ Hexose transporter-like protein OS=Oryza ... 53 7e-06
tr|Q0J1Y6|Q0J1Y6_ORYSJ Os09g0394500 protein OS=Oryza sativa subs... 53 7e-06
tr|B8BF44|B8BF44_ORYSI Putative uncharacterized protein OS=Oryza... 53 7e-06
tr|B7F8I2|B7F8I2_ORYSJ cDNA, clone: J065054A13, full insert sequ... 53 7e-06
tr|A9TH41|A9TH41_PHYPA Predicted protein OS=Physcomitrella paten... 53 7e-06

>tr|Q93WT7|Q93WT7_OLEEU Hexose transporter pGlT OS=Olea europaea
PE=2 SV=1
Length = 544

Score = 79.0 bits (193), Expect = 1e-13
Identities = 36/48 (75%), Positives = 44/48 (91%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
++NF+IGLYFLS VTKFGISTVY GFA+VCL+A +YI+ NVVETKG+S
Sbjct: 485 ISNFVIGLYFLSVVTKFGISTVYLGFASVCLLAVMYIAGNVVETKGRS 532


>tr|O48537|O48537_PRUAR Putative sugar transporter OS=Prunus
armeniaca PE=2 SV=1
Length = 475

Score = 77.8 bits (190), Expect = 3e-13
Identities = 36/48 (75%), Positives = 43/48 (89%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
++NF+IGLYFLS VTKFGIS+VY GFA VCL+A +YIS NVVETKG+S
Sbjct: 416 ISNFVIGLYFLSFVTKFGISSVYLGFAGVCLLAVLYISGNVVETKGRS 463


>tr|Q539E7|Q539E7_VITVI Plastid hexose transporter OS=Vitis vinifera
PE=2 SV=1
Length = 542

Score = 77.4 bits (189), Expect = 3e-13
Identities = 35/48 (72%), Positives = 43/48 (89%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
++NF+IGLYFLS V KFGISTVY GF+AVCL+A +YI+ NVVETKG+S
Sbjct: 483 ISNFVIGLYFLSVVNKFGISTVYLGFSAVCLLAVLYIAGNVVETKGRS 530


>tr|A7PAT0|A7PAT0_VITVI Chromosome chr14 scaffold_9, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038247001
PE=3 SV=1
Length = 519

Score = 77.4 bits (189), Expect = 3e-13
Identities = 35/48 (72%), Positives = 43/48 (89%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
++NF+IGLYFLS V KFGISTVY GF+AVCL+A +YI+ NVVETKG+S
Sbjct: 460 ISNFVIGLYFLSVVNKFGISTVYLGFSAVCLLAVLYIAGNVVETKGRS 507


>tr|Q9LLE1|Q9LLE1_TOBAC Hexose transporter (Fragment) OS=Nicotiana
tabacum GN=pGlcT PE=2 SV=1
Length = 534

Score = 76.3 bits (186), Expect = 7e-13
Identities = 36/48 (75%), Positives = 42/48 (87%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
++NF IGLYFLS VTKFGISTVY GFA+VCL+A +YI NVVETKG+S
Sbjct: 475 ISNFFIGLYFLSIVTKFGISTVYLGFASVCLLAVMYIVGNVVETKGRS 522


>tr|Q9LLE0|Q9LLE0_SOLTU Hexose transporter (Fragment) OS=Solanum
tuberosum GN=pGlcT PE=2 SV=1
Length = 470

Score = 76.3 bits (186), Expect = 7e-13
Identities = 36/48 (75%), Positives = 40/48 (83%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
+ NF IGLYFLS VTKFGISTVY GFA CLVA +YI+ NVVETKG+S
Sbjct: 411 IMNFFIGLYFLSIVTKFGISTVYMGFALSCLVAVVYITGNVVETKGRS 458


>tr|B8LMN4|B8LMN4_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 549

Score = 76.3 bits (186), Expect = 7e-13
Identities = 35/48 (72%), Positives = 41/48 (85%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
V+NF+IGLYFLS V KFGIS VY GFA VCL+A IY++ NVVETKG+S
Sbjct: 490 VSNFVIGLYFLSVVNKFGISKVYLGFATVCLLAVIYVANNVVETKGRS 537


>tr|Q84XS8|Q84XS8_BRARP Putative sugar transporter (Fragment)
OS=Brassica rapa subsp. pekinensis PE=2 SV=1
Length = 170

Score = 75.9 bits (185), Expect = 1e-12
Identities = 34/48 (70%), Positives = 43/48 (89%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
++NF+IGLYFLS VTKFGIS+VY GFA VC++A +YI+ NVVETKG+S
Sbjct: 112 ISNFVIGLYFLSVVTKFGISSVYLGFAGVCVLAVMYIAGNVVETKGRS 159


>tr|Q9FXY8|Q9FXY8_MESCR Putative glucose translocator
OS=Mesembryanthemum crystallinum PE=2 SV=1
Length = 555

Score = 75.1 bits (183), Expect = 2e-12
Identities = 34/47 (72%), Positives = 42/47 (89%)
Frame = +3

Query: 6 TNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
+NF+IGLYFLS VTKFGIS VY GFA+VC++A +YI+ NVVETKG+S
Sbjct: 497 SNFVIGLYFLSVVTKFGISRVYLGFASVCMLAVLYIAGNVVETKGRS 543


>tr|Q5ZCN2|Q5ZCN2_ORYSJ Putative hexose transporter OS=Oryza sativa
subsp. japonica GN=OSJNBa0083M16.20 PE=3 SV=1
Length = 513

Score = 75.1 bits (183), Expect = 2e-12
Identities = 35/48 (72%), Positives = 41/48 (85%)
Frame = +3

Query: 3 VTNFIIGLYFLSAVTKFGISTVYQGFAAVCLVAAIYISQNVVETKGKS 146
V+NF IGLYFLS V KFGISTVY GFA+VC +A +YI+ NVVETKG+S
Sbjct: 454 VSNFFIGLYFLSVVNKFGISTVYLGFASVCALAVVYIAGNVVETKGRS 501