BP918574
Clone id YMU001_000115_B03
Library
Length 468
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000115_B03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAGAAATCAAATTCGACAAGAAATAGCTTCGTCAACATGAGCAAGCTCAGAAAGAAAATG
AGAACCTACTGAGAGAAAAGGATAGCAGAATACAGACATTGGAGAGAACTCTGGAAAGAG
AGAGAGAGGAACTGCGGAGGGATAAGGAGGTACTTAGGGCAGAAAAAGCAAGGAGGCAGA
AAGACCGACAAGCTTATATGGATGCTGTTGCAAAGCTGGACAGTGATAAGCAGAAATTGA
TGGAAGAACTGAGTGTTTTAAAACGAGAGAAAGAGAGTTTTTCCGAGAATGTGCAAGGAA
AAAAAACTGGACGCAAGATAGTCCGACCAAAGATCGAGTCTCCTGTGGCATCACATATTC
AACTCGAAGCAAATGATATGGCAACAGAGGCATTGATAGAGGCATGTGAGACAGAGACGG
AAGTTCGTGATGATGGAAAACCTTCTGCAGAGCTGTAAGAAAGCGTCA
■■Homology search results ■■ -
sp_hit_id P13050
Definition sp|P13050|ARP4_STRPY IgA receptor OS=Streptococcus pyogenes
Align length 150
Score (bit) 45.4
E-value 0.0001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918574|Adiantum capillus-veneris mRNA, clone:
YMU001_000115_B03.
(468 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P13050|ARP4_STRPY IgA receptor OS=Streptococcus pyogenes GN=a... 45 1e-04
sp|P16947|M49_STRP9 M protein, serotype 49 OS=Streptococcus pyog... 45 2e-04
sp|P50470|SPH_STRP1 Immunoglobulin G-binding protein H OS=Strept... 42 0.001
sp|Q076A7|MYH2_CANFA Myosin-2 OS=Canis familiaris GN=MYH2 PE=3 SV=1 38 0.019
sp|Q2KIT1|PKRI1_BOVIN PRKR-interacting protein 1 OS=Bos taurus G... 38 0.025
sp|Q9PTD7|CING_XENLA Cingulin OS=Xenopus laevis GN=cgn PE=1 SV=2 38 0.025
sp|Q9TV63|MYH2_PIG Myosin-2 OS=Sus scrofa GN=MYH2 PE=2 SV=1 37 0.033
sp|Q9UKX2|MYH2_HUMAN Myosin-2 OS=Homo sapiens GN=MYH2 PE=1 SV=1 37 0.033
sp|Q9BE41|MYH2_BOVIN Myosin-2 OS=Bos taurus GN=MYH2 PE=2 SV=1 37 0.033
sp|Q9CWV6|PKRI1_MOUSE PRKR-interacting protein 1 OS=Mus musculus... 37 0.056
sp|Q8MJV1|MYH2_HORSE Myosin-2 OS=Equus caballus GN=MYH2 PE=2 SV=1 37 0.056
sp|Q8BHL3|TB10B_MOUSE TBC1 domain family member 10B OS=Mus muscu... 36 0.095
sp|Q8MSS1|LVA_DROME Protein lava lamp OS=Drosophila melanogaster... 36 0.095
sp|P09790|IGA_NEIGO IgA-specific serine endopeptidase OS=Neisser... 36 0.095
sp|O61308|PUMA_PARUN 227 kDa spindle- and centromere-associated ... 35 0.12
sp|P24733|MYS_AEQIR Myosin heavy chain, striated muscle OS=Aequi... 35 0.12
sp|Q6ZQ06|QN1_MOUSE Protein QN1 homolog OS=Mus musculus GN=Kiaa1... 35 0.16
sp|P13542|MYH8_MOUSE Myosin-8 OS=Mus musculus GN=Myh8 PE=2 SV=2 35 0.16
sp|P13535|MYH8_HUMAN Myosin-8 OS=Homo sapiens GN=MYH8 PE=1 SV=3 35 0.16
sp|Q076A4|MYH8_CANFA Myosin-8 OS=Canis familiaris GN=MYH8 PE=3 SV=1 35 0.16
sp|Q4KLH6|QN1_RAT Protein QN1 homolog OS=Rattus norvegicus GN=Qn... 35 0.21
sp|Q9Y623|MYH4_HUMAN Myosin-4 OS=Homo sapiens GN=MYH4 PE=1 SV=2 35 0.21
sp|B0F9L4|GOGC6_ARATH Golgin candidate 6 OS=Arabidopsis thaliana... 35 0.21
sp|Q9LTC7|BH034_ARATH Transcription factor bHLH34 OS=Arabidopsis... 35 0.21
sp|A6TJ99|SYS_ALKMQ Seryl-tRNA synthetase OS=Alkaliphilus metall... 34 0.28
sp|A4R2R1|NST1_MAGGR Stress response protein NST1 OS=Magnaporthe... 34 0.28
sp|A4XLD4|CNPD_CALS8 2',3'-cyclic-nucleotide 2'-phosphodiesteras... 34 0.28
sp|P22793|TRHY_SHEEP Trichohyalin OS=Ovis aries GN=TCHH PE=2 SV=2 34 0.36
sp|Q07283|TRHY_HUMAN Trichohyalin OS=Homo sapiens GN=TCHH PE=1 SV=2 34 0.36
sp|Q6AYX5|ODFP2_RAT Outer dense fiber protein 2 OS=Rattus norveg... 34 0.36

>sp|P13050|ARP4_STRPY IgA receptor OS=Streptococcus pyogenes GN=arp4
PE=1 SV=1
Length = 386

Score = 45.4 bits (106), Expect = 1e-04
Identities = 31/150 (20%), Positives = 65/150 (43%)
Frame = +3

Query: 3 EIKFDKK*LRQHEQAQKENENLLREKDSRIQXXXXXXXXXXXXXXXDKEVLRAEKARRQK 182
+I+ DK Q ++ Q+E + L EK + DK++ A + +
Sbjct: 132 QIEADKHYQEQQKKHQQEQQQLEAEKQKLAK---------------DKQISDASRQGLSR 176

Query: 183 DRQAYMDAVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPVASHIQ 362
D +A A +L+++ QKL EE + ++ S +++ + +K V + + A H +
Sbjct: 177 DLEASRAAKKELEAEHQKLKEEKQISDASRQGLSRDLEASREAKKKVEADLAALTAEHQK 236

Query: 363 LEANDMATEALIEACETETEVRDDGKPSAE 452
L+ + ++A + + E + K E
Sbjct: 237 LKEDKQISDASRQGLSRDLEASREAKKKVE 266



Score = 29.6 bits (65), Expect = 6.8
Identities = 18/77 (23%), Positives = 39/77 (50%)
Frame = +3

Query: 141 DKEVLRAEKARRQKDRQAYMDAVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKI 320
+KE ++ + Q +RQ ++A ++K +E L+ EK+ +++ Q R+
Sbjct: 114 EKERKEKQERQEQLERQYQIEADKHYQEQQKKHQQEQQQLEAEKQKLAKDKQISDASRQG 173

Query: 321 VRPKIESPVASHIQLEA 371
+ +E+ A+ +LEA
Sbjct: 174 LSRDLEASRAAKKELEA 190


>sp|P16947|M49_STRP9 M protein, serotype 49 OS=Streptococcus
pyogenes serotype M49 GN=emm49 PE=1 SV=1
Length = 389

Score = 44.7 bits (104), Expect = 2e-04
Identities = 28/148 (18%), Positives = 61/148 (41%), Gaps = 7/148 (4%)
Frame = +3

Query: 30 RQHEQAQKENENLLREKDSRIQXXXXXXXXXXXXXXXDKEVLRAEKARRQKDRQAYMDAV 209
++ E+ QK E L R+ ++ +K++ A + +D +A +A
Sbjct: 122 QEQEERQKNQEQLERKYQREVEKRYQEQLQKQQQLETEKQISEASRKSLSRDLEASREAK 181

Query: 210 AKLDSD-------KQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPVASHIQLE 368
K+++D QKL EE + ++ S +++ + +K V + + A H +L+
Sbjct: 182 KKVEADLAALTAEHQKLKEEKQISDASRQGLSRDLEASREAKKKVEADLAALTAEHQKLK 241

Query: 369 ANDMATEALIEACETETEVRDDGKPSAE 452
++A + + E + K E
Sbjct: 242 EEKQISDASRQGLSRDLEASREAKKKVE 269


>sp|P50470|SPH_STRP1 Immunoglobulin G-binding protein H
OS=Streptococcus pyogenes serotype M1 PE=1 SV=1
Length = 376

Score = 42.0 bits (97), Expect = 0.001
Identities = 33/143 (23%), Positives = 62/143 (43%)
Frame = +3

Query: 3 EIKFDKK*LRQHEQAQKENENLLREKDSRIQXXXXXXXXXXXXXXXDKEVLRAEKARRQK 182
E K +K ++ E+ QK E L R+ ++ +K++ A + +
Sbjct: 112 EHKEHQKEQQEQEERQKNQEQLERKYQREVEKRYQEQLQKQQQLETEKQISEASRKSLSR 171

Query: 183 DRQAYMDAVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPVASHIQ 362
D +A A L+++ QKL E LK +K+ + QG + +E+ A+ +
Sbjct: 172 DLEASRAAKKDLEAEHQKLEAEHQKLKEDKQISDASRQG-------LSRDLEASRAAKKE 224

Query: 363 LEANDMATEALIEACETETEVRD 431
LEAN EA + + + ++ D
Sbjct: 225 LEANHQKLEAEHQKLKEDKQISD 247



Score = 34.3 bits (77), Expect = 0.28
Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
Frame = +3

Query: 141 DKEVLRAEKARRQKDRQAYMDAVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKI 320
DK++ A + +D +A A +L+++ QKL E LK +K+ + QG +
Sbjct: 200 DKQISDASRQGLSRDLEASRAAKKELEANHQKLEAEHQKLKEDKQISDASRQGLSRDLEA 259

Query: 321 VRPKIESPVASHIQLEANDMA-TEALIEACETETEVR 428
R + A+H +LEA A E L + E ++R
Sbjct: 260 SRAAKKELEANHQKLEAEAKALKEQLAKQAEELAKLR 296


>sp|Q076A7|MYH2_CANFA Myosin-2 OS=Canis familiaris GN=MYH2 PE=3 SV=1
Length = 1940

Score = 38.1 bits (87), Expect = 0.019
Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 3/95 (3%)
Frame = +3

Query: 177 QKDRQAYMD---AVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPV 347
+++++ MD A KL+ D + E + ++ EK+ E ++ K+ ++ KIE
Sbjct: 1044 EQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEMSNLQSKIEDEQ 1103

Query: 348 ASHIQLEANDMATEALIEACETETEVRDDGKPSAE 452
A IQL+ +A IE E E E + AE
Sbjct: 1104 ALGIQLQKKIKELQARIEELEEEIEAERASRAKAE 1138



Score = 36.2 bits (82), Expect = 0.073
Identities = 23/88 (26%), Positives = 43/88 (48%)
Frame = +3

Query: 162 EKARRQKDRQAYMDAVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIES 341
E A +++ Q D +AK ++ +++L E++ L +EK VQ + G + +
Sbjct: 853 EMATMKEEFQKTKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQAEAEGLADAEERCDQ 912

Query: 342 PVASHIQLEANDMATEALIEACETETEV 425
+ + IQLEA + + E E E E+
Sbjct: 913 LIKTKIQLEAK---IKEVTERAEDEEEI 937


>sp|Q2KIT1|PKRI1_BOVIN PRKR-interacting protein 1 OS=Bos taurus
GN=PRKRIP1 PE=2 SV=1
Length = 186

Score = 37.7 bits (86), Expect = 0.025
Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 5/92 (5%)
Frame = +3

Query: 171 RRQKDRQAYMDAVA---KLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIV--RPKI 335
RR+ RQ YMDA+A KL+++ QK +E + E+ + + K +K++ + K+
Sbjct: 87 RREYQRQDYMDAMAEKQKLEAEFQKRLERNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKL 146

Query: 336 ESPVASHIQLEANDMATEALIEACETETEVRD 431
E S E + + EA TE E D
Sbjct: 147 EQKKQSEASSETQEQPSSGSEEASGTEDEEED 178


>sp|Q9PTD7|CING_XENLA Cingulin OS=Xenopus laevis GN=cgn PE=1 SV=2
Length = 1360

Score = 37.7 bits (86), Expect = 0.025
Identities = 35/134 (26%), Positives = 60/134 (44%), Gaps = 4/134 (2%)
Frame = +3

Query: 3 EIKFDKK*LRQHEQAQKENENLLREKDSRIQXXXXXXXXXXXXXXXDKEVLRAEKARRQK 182
E++ K+ L Q + ++E+E+ L+E R EV A +K
Sbjct: 668 ELRSTKQELLQMKLEKEESEDELKETRDRFSLLQSELAQVKKGSVDPGEV-----ASVRK 722

Query: 183 DRQAYMDAVAKLDSDKQKLMEELSVLKRE----KESFSENVQGKKTGRKIVRPKIESPVA 350
+ Q D + +L DKQK+ E L +RE K + E V G+ +R +++S V
Sbjct: 723 ELQRVQDQLKQLSVDKQKVEENLQQREREMSALKGTLKEEVSGRDRETVRLREQLQSEV- 781

Query: 351 SHIQLEANDMATEA 392
H++ E +A E+
Sbjct: 782 MHVKKENEGLAKES 795


>sp|Q9TV63|MYH2_PIG Myosin-2 OS=Sus scrofa GN=MYH2 PE=2 SV=1
Length = 1939

Score = 37.4 bits (85), Expect = 0.033
Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 3/95 (3%)
Frame = +3

Query: 177 QKDRQAYMD---AVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPV 347
+++++ MD A KL+ D + E + ++ EK+ E ++ K+ ++ KIE
Sbjct: 1043 EQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEISNLQSKIEDEQ 1102

Query: 348 ASHIQLEANDMATEALIEACETETEVRDDGKPSAE 452
A IQL+ +A IE E E E + AE
Sbjct: 1103 ALAIQLQKKIKELQARIEELEEEIEAERASRAKAE 1137



Score = 36.2 bits (82), Expect = 0.073
Identities = 23/88 (26%), Positives = 43/88 (48%)
Frame = +3

Query: 162 EKARRQKDRQAYMDAVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIES 341
E A +++ Q D +AK ++ +++L E++ L +EK VQ + G + +
Sbjct: 852 EMATMKEEFQKTKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQAEAEGLADAEERCDQ 911

Query: 342 PVASHIQLEANDMATEALIEACETETEV 425
+ + IQLEA + + E E E E+
Sbjct: 912 LIKTKIQLEAK---IKEVTERAEDEEEI 936


>sp|Q9UKX2|MYH2_HUMAN Myosin-2 OS=Homo sapiens GN=MYH2 PE=1 SV=1
Length = 1941

Score = 37.4 bits (85), Expect = 0.033
Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 3/95 (3%)
Frame = +3

Query: 177 QKDRQAYMD---AVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPV 347
+++++ MD A KL+ D + E + ++ EK+ E ++ K+ ++ KIE
Sbjct: 1045 EQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEISNLQSKIEDEQ 1104

Query: 348 ASHIQLEANDMATEALIEACETETEVRDDGKPSAE 452
A IQL+ +A IE E E E + AE
Sbjct: 1105 ALGIQLQKKIKELQARIEELEEEIEAERASRAKAE 1139



Score = 36.6 bits (83), Expect = 0.056
Identities = 23/88 (26%), Positives = 43/88 (48%)
Frame = +3

Query: 162 EKARRQKDRQAYMDAVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIES 341
E A +++ Q D +AK ++ +++L E++ L +EK VQ + G + +
Sbjct: 854 EMATMKEEFQKIKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQAEAEGLADAEERCDQ 913

Query: 342 PVASHIQLEANDMATEALIEACETETEV 425
+ + IQLEA + + E E E E+
Sbjct: 914 LIKTKIQLEAK---IKEVTERAEDEEEI 938


>sp|Q9BE41|MYH2_BOVIN Myosin-2 OS=Bos taurus GN=MYH2 PE=2 SV=1
Length = 1940

Score = 37.4 bits (85), Expect = 0.033
Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 3/95 (3%)
Frame = +3

Query: 177 QKDRQAYMD---AVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPV 347
+++++ MD A KL+ D + E + ++ EK+ E ++ K+ ++ KIE
Sbjct: 1044 EQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEISNLQSKIEDEQ 1103

Query: 348 ASHIQLEANDMATEALIEACETETEVRDDGKPSAE 452
A IQL+ +A IE E E E + AE
Sbjct: 1104 ALGIQLQKKIKELQARIEELEEEIEAERASRAKAE 1138



Score = 36.2 bits (82), Expect = 0.073
Identities = 23/88 (26%), Positives = 43/88 (48%)
Frame = +3

Query: 162 EKARRQKDRQAYMDAVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIES 341
E A +++ Q D +AK ++ +++L E++ L +EK VQ + G + +
Sbjct: 853 EMATMKEEFQKTKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQSEAEGLADAEERCDQ 912

Query: 342 PVASHIQLEANDMATEALIEACETETEV 425
+ + IQLEA + + E E E E+
Sbjct: 913 LIKTKIQLEAK---IKEVTERAEDEEEI 937


>sp|Q9CWV6|PKRI1_MOUSE PRKR-interacting protein 1 OS=Mus musculus
GN=Prkrip1 PE=1 SV=2
Length = 186

Score = 36.6 bits (83), Expect = 0.056
Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 5/89 (5%)
Frame = +3

Query: 171 RRQKDRQAYMDAVA---KLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIV--RPKI 335
RR+ RQ YMDA+A KLD++ QK +E+ + E+ + + K +K++ + K+
Sbjct: 87 RREYQRQDYMDAMAEKQKLDAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKL 146

Query: 336 ESPVASHIQLEANDMATEALIEACETETE 422
E + + + EA ETE E
Sbjct: 147 EQKKQKEEPSQCQEQHASSSDEASETEEE 175


tr_hit_id Q8GL97
Definition tr|Q8GL97|Q8GL97_STRPY M protein (Fragment) OS=Streptococcus pyogenes
Align length 150
Score (bit) 51.6
E-value 2.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918574|Adiantum capillus-veneris mRNA, clone:
YMU001_000115_B03.
(468 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8GL97|Q8GL97_STRPY M protein (Fragment) OS=Streptococcus pyo... 52 2e-05
tr|A4UNT2|A4UNT2_STRPY M protein (Fragment) OS=Streptococcus pyo... 52 2e-05
tr|Q4ZGP0|Q4ZGP0_STRPY M protein (Fragment) OS=Streptococcus pyo... 51 3e-05
tr|A4UNT3|A4UNT3_STRPY M protein (Fragment) OS=Streptococcus pyo... 51 3e-05
tr|Q54745|Q54745_STRPY Emm50 OS=Streptococcus pyogenes GN=emm50 ... 50 7e-05
tr|Q6TLQ3|Q6TLQ3_STRPY M protein (Fragment) OS=Streptococcus pyo... 49 1e-04
tr|Q19KV8|Q19KV8_STRPY M protein (Fragment) OS=Streptococcus pyo... 49 1e-04
tr|A4UNU0|A4UNU0_STRPY M protein (Fragment) OS=Streptococcus pyo... 49 1e-04
tr|Q4ZGN9|Q4ZGN9_STRPY M protein (Fragment) OS=Streptococcus pyo... 48 2e-04
tr|A4UNT6|A4UNT6_STRPY M protein (Fragment) OS=Streptococcus pyo... 48 2e-04
tr|O85811|O85811_STRPY M protein (Fragment) OS=Streptococcus pyo... 47 4e-04
tr|Q9AMM5|Q9AMM5_STRPY Emm58 OS=Streptococcus pyogenes GN=emm58 ... 47 5e-04
tr|Q4ZGP8|Q4ZGP8_STRPY M protein (Fragment) OS=Streptococcus pyo... 47 5e-04
tr|Q19KV7|Q19KV7_STRPY M protein (Fragment) OS=Streptococcus pyo... 47 5e-04
tr|A4UNT9|A4UNT9_STRPY M protein (Fragment) OS=Streptococcus pyo... 47 5e-04
tr|A4UNT0|A4UNT0_STRPY M protein (Fragment) OS=Streptococcus pyo... 47 5e-04
tr|Q54841|Q54841_STRPY M-type 9 protein OS=Streptococcus pyogene... 47 6e-04
tr|Q19KV9|Q19KV9_STRPY M protein (Fragment) OS=Streptococcus pyo... 47 6e-04
tr|B8YGF9|B8YGF9_STRPY M protein (Fragment) OS=Streptococcus pyo... 47 6e-04
tr|B3GA05|B3GA05_STRPY M protein (Fragment) OS=Streptococcus pyo... 47 6e-04
tr|A7XPA9|A7XPA9_STRPY M protein (Fragment) OS=Streptococcus pyo... 47 6e-04
tr|A4UNS8|A4UNS8_STRPY M protein (Fragment) OS=Streptococcus pyo... 47 6e-04
tr|Q8GL85|Q8GL85_STRPY M protein (Fragment) OS=Streptococcus pyo... 46 8e-04
tr|Q4ZGP6|Q4ZGP6_STRPY M protein (Fragment) OS=Streptococcus pyo... 46 8e-04
tr|B3GA06|B3GA06_STRPY M protein (Fragment) OS=Streptococcus pyo... 46 8e-04
tr|A5AYB9|A5AYB9_VITVI Putative uncharacterized protein OS=Vitis... 46 8e-04
tr|Q6TLQ5|Q6TLQ5_STRPY M protein (Fragment) OS=Streptococcus pyo... 46 0.001
tr|Q4ZGP9|Q4ZGP9_STRPY M protein (Fragment) OS=Streptococcus pyo... 45 0.001
tr|B8YGE4|B8YGE4_STRPY M protein (Fragment) OS=Streptococcus pyo... 45 0.001
tr|Q9R5X5|Q9R5X5_STRPY EMML15=M-like immunoglobulin-binding prot... 45 0.002

>tr|Q8GL97|Q8GL97_STRPY M protein (Fragment) OS=Streptococcus
pyogenes GN=emm PE=4 SV=1
Length = 289

Score = 51.6 bits (122), Expect = 2e-05
Identities = 31/150 (20%), Positives = 65/150 (43%)
Frame = +3

Query: 3 EIKFDKK*LRQHEQAQKENENLLREKDSRIQXXXXXXXXXXXXXXXDKEVLRAEKARRQK 182
E K +K ++ E+ QK E L R+ ++ +K++ A + +
Sbjct: 94 EHKEHQKEQQEQEERQKNQEQLERQSQREVEKRYQEQLQKQQQLEKEKQISEASRKSLSR 153

Query: 183 DRQAYMDAVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPVASHIQ 362
D +A A +L+++ QKL EE + ++S S +++ + +K V + + A H +
Sbjct: 154 DLEASRAAKKELEAEHQKLKEEKQISDASRKSLSRDLEASREAKKKVEADLAALTAEHQK 213

Query: 363 LEANDMATEALIEACETETEVRDDGKPSAE 452
L+ ++A + + E + K E
Sbjct: 214 LKEEKQISDASRQGLSRDLEASREAKKKVE 243


>tr|A4UNT2|A4UNT2_STRPY M protein (Fragment) OS=Streptococcus
pyogenes GN=emm PE=4 SV=1
Length = 365

Score = 51.6 bits (122), Expect = 2e-05
Identities = 31/150 (20%), Positives = 65/150 (43%)
Frame = +3

Query: 3 EIKFDKK*LRQHEQAQKENENLLREKDSRIQXXXXXXXXXXXXXXXDKEVLRAEKARRQK 182
E K +K ++ E+ QK E L R+ ++ +K++ A + +
Sbjct: 107 EHKEHQKEQQEQEERQKNQEQLERQSQREVEKRYQEQLQKQQQLEKEKQISEASRKSLSR 166

Query: 183 DRQAYMDAVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPVASHIQ 362
D +A A +L+++ QKL EE + ++S S +++ + +K V + + A H +
Sbjct: 167 DLEASRAAKKELEAEHQKLKEEKQISDASRKSLSRDLEASREAKKKVEADLAALTAEHQK 226

Query: 363 LEANDMATEALIEACETETEVRDDGKPSAE 452
L+ ++A + + E + K E
Sbjct: 227 LKEEKQISDASRQGLSRDLEASREAKKKVE 256


>tr|Q4ZGP0|Q4ZGP0_STRPY M protein (Fragment) OS=Streptococcus
pyogenes GN=emm PE=4 SV=1
Length = 308

Score = 50.8 bits (120), Expect = 3e-05
Identities = 31/150 (20%), Positives = 64/150 (42%)
Frame = +3

Query: 3 EIKFDKK*LRQHEQAQKENENLLREKDSRIQXXXXXXXXXXXXXXXDKEVLRAEKARRQK 182
E K +K ++ E+ QK E L R+ ++ +K++ A + +
Sbjct: 106 EHKEHQKEQQEQEERQKNQEQLERQSQREVEKRYQEQLQKQQQLEKEKQISEASRKSLSR 165

Query: 183 DRQAYMDAVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPVASHIQ 362
D +A A L+++ QKL EE + ++S S +++ + +K V + + A H +
Sbjct: 166 DLEASRAAKKDLEAEHQKLKEEKQISDASRKSLSRDLEASREAKKKVEADLAALTAEHQK 225

Query: 363 LEANDMATEALIEACETETEVRDDGKPSAE 452
L+ ++A + + E + K E
Sbjct: 226 LKEEKQISDASRQGLSRDLEASREAKKKVE 255


>tr|A4UNT3|A4UNT3_STRPY M protein (Fragment) OS=Streptococcus
pyogenes GN=emm PE=4 SV=1
Length = 375

Score = 50.8 bits (120), Expect = 3e-05
Identities = 31/150 (20%), Positives = 64/150 (42%)
Frame = +3

Query: 3 EIKFDKK*LRQHEQAQKENENLLREKDSRIQXXXXXXXXXXXXXXXDKEVLRAEKARRQK 182
E K +K ++ E+ QK E L R+ ++ +K++ A + +
Sbjct: 117 EHKEHQKEQQEQEERQKNQEQLERQSQREVEKRYQEQLQKQQQLEKEKQISEASRKSLSR 176

Query: 183 DRQAYMDAVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPVASHIQ 362
D +A A L+++ QKL EE + ++S S +++ + +K V + + A H +
Sbjct: 177 DLEASRAAKKDLEAEHQKLKEEKQISDASRKSLSRDLEASREAKKKVEADLAALTAEHQK 236

Query: 363 LEANDMATEALIEACETETEVRDDGKPSAE 452
L+ ++A + + E + K E
Sbjct: 237 LKEEKQISDASRQGLSRDLEASREAKKKVE 266


>tr|Q54745|Q54745_STRPY Emm50 OS=Streptococcus pyogenes GN=emm50
PE=4 SV=1
Length = 413

Score = 49.7 bits (117), Expect = 7e-05
Identities = 28/141 (19%), Positives = 60/141 (42%)
Frame = +3

Query: 30 RQHEQAQKENENLLREKDSRIQXXXXXXXXXXXXXXXDKEVLRAEKARRQKDRQAYMDAV 209
++ E+ QK E L R+ ++ +K++ A + +D +A A
Sbjct: 111 QEQEERQKYQEQLERQSQREVEKRYQEQLQKQQQLEKEKQISEASRKSLSRDLEASRAAK 170

Query: 210 AKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPVASHIQLEANDMATE 389
+L+++ QKL EE + ++ S +++ + +K V + + A H +L+ +E
Sbjct: 171 KELEAEHQKLKEEKQISDASRQGLSRDLEASREAKKKVEADLAALTAEHQKLKEEKQISE 230

Query: 390 ALIEACETETEVRDDGKPSAE 452
A + + E + K E
Sbjct: 231 ASRQGLSRDLEASREAKKKVE 251



Score = 37.4 bits (85), Expect = 0.38
Identities = 22/111 (19%), Positives = 50/111 (45%), Gaps = 7/111 (6%)
Frame = +3

Query: 141 DKEVLRAEKARRQKDRQAYMDAVAKLDSD-------KQKLMEELSVLKREKESFSENVQG 299
+K++ A + +D +A +A K+++D QKL EE + + ++ S +++
Sbjct: 183 EKQISDASRQGLSRDLEASREAKKKVEADLAALTAEHQKLKEEKQISEASRQGLSRDLEA 242

Query: 300 KKTGRKIVRPKIESPVASHIQLEANDMATEALIEACETETEVRDDGKPSAE 452
+ +K V + + A H +L+ ++A + + E + K E
Sbjct: 243 SREAKKKVEADLAALTAEHQKLKEEKQISDASRQGLSRDLEASREAKKKVE 293


>tr|Q6TLQ3|Q6TLQ3_STRPY M protein (Fragment) OS=Streptococcus
pyogenes GN=emm PE=4 SV=1
Length = 254

Score = 48.9 bits (115), Expect = 1e-04
Identities = 30/150 (20%), Positives = 64/150 (42%)
Frame = +3

Query: 3 EIKFDKK*LRQHEQAQKENENLLREKDSRIQXXXXXXXXXXXXXXXDKEVLRAEKARRQK 182
++K ++ ++ E+ QK E L R+ I +K++ A + +
Sbjct: 91 QVKKHQEYKQEQEERQKNLEELERQNKREIDKRYQEQLQKQQQLETEKQISEASRKSLSR 150

Query: 183 DRQAYMDAVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPVASHIQ 362
D +A A L+++ QKL EE + ++S S +++ + +K V + + A H +
Sbjct: 151 DLEASRAAKKDLEAEHQKLKEEKQISDASRQSLSRDLEASREAKKKVEADLAALTAEHQK 210

Query: 363 LEANDMATEALIEACETETEVRDDGKPSAE 452
L+ ++A + + E + K E
Sbjct: 211 LKEEKQISDASRQGLSRDLEASREAKKKVE 240


>tr|Q19KV8|Q19KV8_STRPY M protein (Fragment) OS=Streptococcus
pyogenes GN=emm PE=4 SV=1
Length = 285

Score = 48.9 bits (115), Expect = 1e-04
Identities = 30/150 (20%), Positives = 64/150 (42%)
Frame = +3

Query: 3 EIKFDKK*LRQHEQAQKENENLLREKDSRIQXXXXXXXXXXXXXXXDKEVLRAEKARRQK 182
++K ++ ++ E+ QK E L R+ I +K++ A + +
Sbjct: 89 QVKKHQEYKQEQEERQKNLEELERQNKREIDKRYQEQLQKQQQLETEKQISEASRKSLSR 148

Query: 183 DRQAYMDAVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPVASHIQ 362
D +A A L+++ QKL EE + ++S S +++ + +K V + + A H +
Sbjct: 149 DLEASRAAKKDLEAEHQKLKEEKQISDASRQSLSRDLEASREAKKKVEADLAALTAEHQK 208

Query: 363 LEANDMATEALIEACETETEVRDDGKPSAE 452
L+ ++A + + E + K E
Sbjct: 209 LKEEKQISDASRQGLSRDLEASREAKKKVE 238


>tr|A4UNU0|A4UNU0_STRPY M protein (Fragment) OS=Streptococcus
pyogenes GN=emm PE=4 SV=1
Length = 359

Score = 48.9 bits (115), Expect = 1e-04
Identities = 30/150 (20%), Positives = 64/150 (42%)
Frame = +3

Query: 3 EIKFDKK*LRQHEQAQKENENLLREKDSRIQXXXXXXXXXXXXXXXDKEVLRAEKARRQK 182
++K ++ ++ E+ QK E L R+ I +K++ A + +
Sbjct: 101 QVKKHQEYKQEQEERQKNLEELERQNKREIDKRYQEQLQKQQQLETEKQISEASRKSLSR 160

Query: 183 DRQAYMDAVAKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPVASHIQ 362
D +A A L+++ QKL EE + ++S S +++ + +K V + + A H +
Sbjct: 161 DLEASRAAKKDLEAEHQKLKEEKQISDASRQSLSRDLEASREAKKKVEADLAALTAEHQK 220

Query: 363 LEANDMATEALIEACETETEVRDDGKPSAE 452
L+ ++A + + E + K E
Sbjct: 221 LKEEKQISDASRQGLSRDLEASREAKKKVE 250


>tr|Q4ZGN9|Q4ZGN9_STRPY M protein (Fragment) OS=Streptococcus
pyogenes GN=emm PE=4 SV=1
Length = 307

Score = 48.1 bits (113), Expect = 2e-04
Identities = 28/141 (19%), Positives = 60/141 (42%)
Frame = +3

Query: 30 RQHEQAQKENENLLREKDSRIQXXXXXXXXXXXXXXXDKEVLRAEKARRQKDRQAYMDAV 209
++ ++ QK E L R+ I +K++ A + +D +A A
Sbjct: 116 KEQQERQKNLEELERQNQREIDKRYQEQLQKQQQLETEKQISEASRKSLSRDLEASRAAK 175

Query: 210 AKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPVASHIQLEANDMATE 389
+L+++ QKL EE + ++S S +++ + +K V + + A H +L+ ++
Sbjct: 176 KELEAEHQKLKEEKQISDASRKSLSRDLEASREAKKKVEADLAALTAEHQKLKEEKQISD 235

Query: 390 ALIEACETETEVRDDGKPSAE 452
A + + E + K E
Sbjct: 236 ASRQGLSRDLEASREAKKKVE 256


>tr|A4UNT6|A4UNT6_STRPY M protein (Fragment) OS=Streptococcus
pyogenes GN=emm PE=4 SV=1
Length = 364

Score = 48.1 bits (113), Expect = 2e-04
Identities = 27/141 (19%), Positives = 60/141 (42%)
Frame = +3

Query: 30 RQHEQAQKENENLLREKDSRIQXXXXXXXXXXXXXXXDKEVLRAEKARRQKDRQAYMDAV 209
++ E+ QK E L R+ ++ +K++ A + +D +A A
Sbjct: 115 QEQEERQKNQEQLERKYQREVEKRYQEQLQKQQQLETEKQISEASRKSLSRDLEASRAAK 174

Query: 210 AKLDSDKQKLMEELSVLKREKESFSENVQGKKTGRKIVRPKIESPVASHIQLEANDMATE 389
+L+++ QKL EE + ++ S +++ + +K V + + A H +L+ ++
Sbjct: 175 KELEAEHQKLKEEKQISDASRQGLSRDLEASREAKKKVEADLAALTAEHQKLKEEKQISD 234

Query: 390 ALIEACETETEVRDDGKPSAE 452
A + + E + K E
Sbjct: 235 ASRQGLSRDLEASREAKKKVE 255