BP918575
Clone id YMU001_000115_B04
Library
Length 468
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000115_B04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TATAATTACAAGCAACAAATCCTTCAACTTATTTACAAAAGACCAATTGACCACCATTTC
AAGGTCCCTTGGCTACCTGCTGTACAGGTCCAATTGCAAAGAATCAGATGTCACCAATCA
ATGTAACAATTACCTAGCTATCCTCACAAGCAATGTATTGATTGATGTGCGCTTAAGACT
ACCAGCTAATTTGTTCGATCCTCAAATCCGCTCTGAAAAACCGATACTTGTACTTCGGGA
AACATATTCCGGATTCTCATCTTGACTGACATTAAGATCAATGTATTCCTCACTCTCATC
AAAATCAATGTAGTCCAGAGCTTCCTCTTGATTACCATTGAACTCATTGGATTCTGGATT
CTCTTCTAATCTGACATTAGAATCATCTGTATCGGTAACCGACACTTGTTTAATTACCTC
AAACACTACATTAACTGGCCAGAATGATACGGTCTTCCTGGTGGAGAA
■■Homology search results ■■ -
sp_hit_id O60097
Definition sp|O60097|SPT8_SCHPO Transcription factor spt8 OS=Schizosaccharomyces pombe
Align length 47
Score (bit) 41.2
E-value 0.002
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918575|Adiantum capillus-veneris mRNA, clone:
YMU001_000115_B04.
(468 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O60097|SPT8_SCHPO Transcription factor spt8 OS=Schizosaccharo... 41 0.002
sp|Q6BN88|ATG26_DEBHA Sterol 3-beta-glucosyltransferase OS=Debar... 32 1.1
sp|Q4JCA6|SYC_SULAC Cysteinyl-tRNA synthetase OS=Sulfolobus acid... 32 1.4
sp|P31380|YAB9_YEAST Uncharacterized ATP-dependent helicase YAL0... 31 2.4
sp|P45489|Y990_CAMJE Uncharacterized protein Cj0990c OS=Campylob... 31 2.4
sp|P51860|NP1L2_MOUSE Nucleosome assembly protein 1-like 2 OS=Mu... 31 2.4
sp|P36123|SA190_YEAST SIT4-associating protein SAP190 OS=Sacchar... 31 3.1
sp|Q03MQ8|RPOE_STRTD Probable DNA-directed RNA polymerase subuni... 31 3.1
sp|Q5M6C1|RPOE_STRT2 Probable DNA-directed RNA polymerase subuni... 31 3.1
sp|Q5M1S8|RPOE_STRT1 Probable DNA-directed RNA polymerase subuni... 31 3.1
sp|Q54CD8|DDX54_DICDI ATP-dependent RNA helicase ddx54 OS=Dictyo... 31 3.1
sp|Q95K63|STOX2_MACFA Storkhead-box protein 2 OS=Macaca fascicul... 30 4.1
sp|Q04XC4|TILS_LEPBL tRNA(Ile)-lysidine synthase OS=Leptospira b... 30 5.2
sp|Q04W48|TILS_LEPBJ tRNA(Ile)-lysidine synthase OS=Leptospira b... 30 5.2
sp|Q06FP6|YCF1_PELHO Putative membrane protein ycf1 OS=Pelargoni... 30 5.3
sp|Q8LRK9|TAF1A_ARATH Transcription initiation factor TFIID subu... 30 5.3
sp|A6LPQ4|RPOB_CLOB8 DNA-directed RNA polymerase subunit beta OS... 30 5.3
sp|A3LVD5|ESF2_PICST Pre-rRNA-processing protein ESF2 OS=Pichia ... 30 6.9
sp|O18805|DAXX_CERAE Death domain-associated protein 6 OS=Cercop... 30 6.9
sp|Q9P2F5|STOX2_HUMAN Storkhead-box protein 2 OS=Homo sapiens GN... 29 9.1
sp|Q97HC8|NUSB_CLOAB N utilization substance protein B homolog O... 29 9.1
sp|Q810V0|MPP10_MOUSE U3 small nucleolar ribonucleoprotein prote... 29 9.1
sp|O35821|MBB1A_RAT Myb-binding protein 1A OS=Rattus norvegicus ... 29 9.1
sp|Q6BGW1|GCN5_DEBHA Histone acetyltransferase GCN5 OS=Debaryomy... 29 9.1
sp|O74191|FKBP4_SCHPO FK506-binding protein 39 kDa OS=Schizosacc... 29 9.1
sp|Q54CT0|COG6_DICDI Conserved oligomeric Golgi complex subunit ... 29 9.1

>sp|O60097|SPT8_SCHPO Transcription factor spt8
OS=Schizosaccharomyces pombe GN=spt8 PE=2 SV=1
Length = 526

Score = 41.2 bits (95), Expect = 0.002
Identities = 16/47 (34%), Positives = 30/47 (63%)
Frame = -1

Query: 393 DTDDSNVRLEENPESNEFNGNQEEALDYIDFDESEEYIDLNVSQDEN 253
D DD+++ ++NPE N N ++E +D +D EE ++++ +DEN
Sbjct: 24 DDDDADMDQDKNPEENVMNEKEDEDVDAVDEKSGEEDVEMDTMEDEN 70


>sp|Q6BN88|ATG26_DEBHA Sterol 3-beta-glucosyltransferase
OS=Debaryomyces hansenii GN=ATG26 PE=3 SV=2
Length = 1574

Score = 32.3 bits (72), Expect = 1.1
Identities = 19/44 (43%), Positives = 27/44 (61%)
Frame = -1

Query: 384 DSNVRLEENPESNEFNGNQEEALDYIDFDESEEYIDLNVSQDEN 253
+ N+R N ++NE +E LDY D DESEE D+ ++DEN
Sbjct: 114 NDNLRSSRNEQANEPEYRREYKLDY-DIDESEE-DDIESTRDEN 155


>sp|Q4JCA6|SYC_SULAC Cysteinyl-tRNA synthetase OS=Sulfolobus
acidocaldarius GN=cysS PE=3 SV=1
Length = 469

Score = 32.0 bits (71), Expect = 1.4
Identities = 20/67 (29%), Positives = 30/67 (44%)
Frame = -1

Query: 423 FEVIKQVSVTDTDDSNVRLEENPESNEFNGNQEEALDYIDFDESEEYIDLNVSQDENPEY 244
F VI+ ++TD DD ++ +NE + E +DY D E L V D++P
Sbjct: 61 FNVIRVQNITDIDDKIIK-----RANETGKDWREIVDYYTKDYMESLKALKVEIDQHPRV 115

Query: 243 VSRSTSI 223
S I
Sbjct: 116 TSHIQEI 122


>sp|P31380|YAB9_YEAST Uncharacterized ATP-dependent helicase YAL019W
OS=Saccharomyces cerevisiae GN=YAL019W PE=1 SV=1
Length = 1131

Score = 31.2 bits (69), Expect = 2.4
Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 5/59 (8%)
Frame = -1

Query: 399 VTDTDDSNVRLE----ENPES-NEFNGNQEEALDYIDFDESEEYIDLNVSQDENPEYVS 238
V + +D +V LE E P+S +E + +EE DY D +E EY D + D++ E+V+
Sbjct: 478 VVEDEDDDVDLEAIDDELPQSEHEDDDYEEEDEDYNDEEEDVEYDDGDDDDDDDDEFVA 536


>sp|P45489|Y990_CAMJE Uncharacterized protein Cj0990c
OS=Campylobacter jejuni GN=Cj0990c PE=1 SV=2
Length = 253

Score = 31.2 bits (69), Expect = 2.4
Identities = 16/53 (30%), Positives = 33/53 (62%)
Frame = -1

Query: 420 EVIKQVSVTDTDDSNVRLEENPESNEFNGNQEEALDYIDFDESEEYIDLNVSQ 262
E++K ++ DT+D + + + +SN+ N NQE+ +++ + +SE+ I N Q
Sbjct: 59 EIVKHFNICDTEDMIIVEDFDMKSNKDNQNQEDDIEH-NILKSEKIIHENTKQ 110


>sp|P51860|NP1L2_MOUSE Nucleosome assembly protein 1-like 2 OS=Mus
musculus GN=Nap1l2 PE=2 SV=1
Length = 460

Score = 31.2 bits (69), Expect = 2.4
Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 3/66 (4%)
Frame = -1

Query: 435 VNVVFEVIKQVSVTDTDDSNVRLEENPESNEFNGNQEEAL-DYIDFDESEE--YIDLNVS 265
+N V+E ++ +D + EE E E NGN++ + +Y+D D+ E Y D +
Sbjct: 155 INAVYEPTEEECEYKSDCEDYFEEEMDEEEETNGNEDGMVHEYVDEDDGYEDCYYDYDDE 214

Query: 264 QDENPE 247
++E E
Sbjct: 215 EEEEEE 220


>sp|P36123|SA190_YEAST SIT4-associating protein SAP190
OS=Saccharomyces cerevisiae GN=SAP190 PE=1 SV=2
Length = 1033

Score = 30.8 bits (68), Expect = 3.1
Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 2/63 (3%)
Frame = -1

Query: 387 DDSNVRLEENPESNEFNGNQEEALDYIDFDESEEYIDLNVSQD--ENPEYVSRSTSIGFS 214
D N+ L N +NE N+E+ +Y D D Y ++ + D ++ + S+S F+
Sbjct: 811 DSGNMDLYYNFNNNENEENEEDYAEYSDVDNKNYYNNVETNDDDYDSDDGKSKSAESEFT 870

Query: 213 ERI 205
++I
Sbjct: 871 DKI 873


>sp|Q03MQ8|RPOE_STRTD Probable DNA-directed RNA polymerase subunit
delta OS=Streptococcus thermophilus (strain ATCC BAA-491
/ LMD-9) GN=rpoE PE=3 SV=1
Length = 191

Score = 30.8 bits (68), Expect = 3.1
Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 9/75 (12%)
Frame = -1

Query: 420 EVIKQVSVTDTDDSNVRLEENPESNEFNGNQEEALDYIDFDESEEYI---------DLNV 268
E+ ++V + D N +N + N F E+A+DY D D +E D +
Sbjct: 88 EIDEEVITLEDIDENAPKRKNKKVNAFMDGDEDAIDYNDDDPEDENFTPSSAILEYDNDN 147

Query: 267 SQDENPEYVSRSTSI 223
DEN E S + +
Sbjct: 148 EDDENAEVESYDSEL 162


>sp|Q5M6C1|RPOE_STRT2 Probable DNA-directed RNA polymerase subunit
delta OS=Streptococcus thermophilus (strain ATCC BAA-250
/ LMG 18311) GN=rpoE PE=3 SV=1
Length = 193

Score = 30.8 bits (68), Expect = 3.1
Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 9/75 (12%)
Frame = -1

Query: 420 EVIKQVSVTDTDDSNVRLEENPESNEFNGNQEEALDYIDFDESEEYI---------DLNV 268
E+ ++V + D N +N + N F E+A+DY D D +E D +
Sbjct: 88 EIDEEVITLEDIDENAPKRKNKKVNAFMDGDEDAIDYNDDDPEDENFTPSSAILEYDNDN 147

Query: 267 SQDENPEYVSRSTSI 223
DEN E S + +
Sbjct: 148 EDDENAEVESYDSEL 162


>sp|Q5M1S8|RPOE_STRT1 Probable DNA-directed RNA polymerase subunit
delta OS=Streptococcus thermophilus (strain CNRZ 1066)
GN=rpoE PE=3 SV=1
Length = 193

Score = 30.8 bits (68), Expect = 3.1
Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 9/75 (12%)
Frame = -1

Query: 420 EVIKQVSVTDTDDSNVRLEENPESNEFNGNQEEALDYIDFDESEEYI---------DLNV 268
E+ ++V + D N +N + N F E+A+DY D D +E D +
Sbjct: 88 EIDEEVITLEDIDENAPKRKNKKVNAFMDGDEDAIDYNDDDPEDENFTPSSAILEYDNDN 147

Query: 267 SQDENPEYVSRSTSI 223
DEN E S + +
Sbjct: 148 EDDENAEVESYDSEL 162


tr_hit_id A6SBE3
Definition tr|A6SBE3|A6SBE3_BOTFB Predicted protein OS=Botryotinia fuckeliana (strain B05.10)
Align length 90
Score (bit) 41.6
E-value 0.02
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918575|Adiantum capillus-veneris mRNA, clone:
YMU001_000115_B04.
(468 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A6SBE3|A6SBE3_BOTFB Predicted protein OS=Botryotinia fuckelia... 42 0.020
tr|A7EP75|A7EP75_SCLS1 Predicted protein OS=Sclerotinia scleroti... 40 0.076
tr|Q07DP5|Q07DP5_DROME TATA box binding protein-related factor 2... 39 0.100
tr|A0BRV7|A0BRV7_PARTE Chromosome undetermined scaffold_123, who... 38 0.29
tr|Q5A892|Q5A892_CANAL Potential ubiquitin-protein ligase OS=Can... 38 0.29
tr|Q8T1D9|Q8T1D9_DICDI Putative uncharacterized protein OS=Dicty... 36 0.84
tr|A8NR32|A8NR32_BRUMA Putative uncharacterized protein OS=Brugi... 35 1.4
tr|B4JGX2|B4JGX2_DROGR GH19501 OS=Drosophila grimshawi GN=GH1950... 35 2.5
tr|A3GFZ3|A3GFZ3_PICST Putative uncharacterized protein FKH3 OS=... 35 2.5
tr|Q3YT86|Q3YT86_EHRCJ TRAG protein OS=Ehrlichia canis (strain J... 34 3.2
tr|B1RXC6|B1RXC6_UREUR tRNA(Ile)-lysidine synthetase OS=Ureaplas... 34 3.2
tr|A9SZ04|A9SZ04_PHYPA Predicted protein OS=Physcomitrella paten... 34 3.2
tr|Q4Z3E8|Q4Z3E8_PLABE Putative uncharacterized protein OS=Plasm... 34 3.2
tr|Q4YKR6|Q4YKR6_PLABE Putative uncharacterized protein (Fragmen... 34 3.2
tr|Q22Y14|Q22Y14_TETTH Putative uncharacterized protein OS=Tetra... 34 3.2
tr|B3NN99|B3NN99_DROER GG20736 OS=Drosophila erecta GN=GG20736 P... 34 3.2
tr|Q7RQS8|Q7RQS8_PLAYO Retinitis pigmentosa GTPase regulator-lik... 34 4.2
tr|Q7RCM2|Q7RCM2_PLAYO Putative uncharacterized protein PY05757 ... 34 4.2
tr|Q4Z133|Q4Z133_PLABE Putative uncharacterized protein (Fragmen... 34 4.2
tr|Q4N329|Q4N329_THEPA Putative uncharacterized protein OS=Theil... 34 4.2
tr|B3LD41|B3LD41_PLAKH Putative uncharacterized protein OS=Plasm... 34 4.2
tr|Q5TQV4|Q5TQV4_ANOGA AGAP006512-PA OS=Anopheles gambiae GN=AGA... 34 4.2
tr|A4S0W4|A4S0W4_OSTLU Predicted protein OS=Ostreococcus lucimar... 33 5.5
tr|Q5CTD1|Q5CTD1_CRYPV Cus1p U2 snRNP protein OS=Cryptosporidium... 33 5.5
tr|Q4N896|Q4N896_THEPA Putative uncharacterized protein OS=Theil... 33 5.5
tr|Q4CN97|Q4CN97_TRYCR Mucin-associated surface protein (MASP), ... 33 5.5
tr|B3S3Q1|B3S3Q1_TRIAD Putative uncharacterized protein OS=Trich... 33 5.5
tr|B5ZAQ6|B5ZAQ6_UREU1 tRNA(Ile)-lysidine synthetase OS=Ureaplas... 33 7.1
tr|B5BME4|B5BME4_UREUR tRNA(Ile)-lysidine synthetase OS=Ureaplas... 33 7.1
tr|B3XV26|B3XV26_UREUR tRNA(Ile)-lysidine synthetase OS=Ureaplas... 33 7.1

>tr|A6SBE3|A6SBE3_BOTFB Predicted protein OS=Botryotinia fuckeliana
(strain B05.10) GN=BC1G_10194 PE=4 SV=1
Length = 922

Score = 41.6 bits (96), Expect = 0.020
Identities = 29/90 (32%), Positives = 42/90 (46%), Gaps = 14/90 (15%)
Frame = -1

Query: 465 STRKTVSFWPVNVVFEVIKQVS--VTDTDD------------SNVRLEENPESNEFNGNQ 328
S RK+VS N E+ Q+ T TD+ S++ EE N FN +
Sbjct: 619 SPRKSVSNKTENASVELDDQLGDETTHTDEAAQPKEIFHDAESDIDYEEENADNNFNSEE 678

Query: 327 EEALDYIDFDESEEYIDLNVSQDENPEYVS 238
E+ D + +E+ IDLN + DE+ EY S
Sbjct: 679 EDRAVLKDIENAEDEIDLNATNDEDREYAS 708


>tr|A7EP75|A7EP75_SCLS1 Predicted protein OS=Sclerotinia
sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)
GN=SS1G_07124 PE=4 SV=1
Length = 874

Score = 39.7 bits (91), Expect = 0.076
Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 14/88 (15%)
Frame = -1

Query: 465 STRKTVSFWPVNVVFEVIKQVS--VTDTDD------------SNVRLEENPESNEFNGNQ 328
S R ++S N V EV QV T TDD S++ EE + FN +
Sbjct: 573 SRRNSISLKVENAVTEVESQVGDETTHTDDTAQPEETFQDVESDIDYEEEKADDGFNAEE 632

Query: 327 EEALDYIDFDESEEYIDLNVSQDENPEY 244
+E + D + +E I+LN + DE+ EY
Sbjct: 633 QEGSEPNDLENAENGINLNETNDEDREY 660


>tr|Q07DP5|Q07DP5_DROME TATA box binding protein-related factor 2
OS=Drosophila melanogaster GN=Trf2 PE=2 SV=1
Length = 1715

Score = 39.3 bits (90), Expect = 0.100
Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
Frame = -1

Query: 408 QVSVTDTDDSNVRLEENPESNEFNGNQEEALDYIDFDESEEYIDLN-VSQDENPEY 244
Q S DSN +E SN+ + ++ + L++ D D S+EY DLN V+QD N EY
Sbjct: 283 QESNHGNQDSNDEYQELNHSNQDSNDEYQELNHGDQDSSDEYQDLNHVNQDSNHEY 338


>tr|A0BRV7|A0BRV7_PARTE Chromosome undetermined scaffold_123, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00031505001 PE=4 SV=1
Length = 454

Score = 37.7 bits (86), Expect = 0.29
Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
Frame = -1

Query: 441 WPVNVVFEVI-KQVSVTDTDDSNVRLEENPESNEFNGNQEEALDYIDFDESEEYIDLNVS 265
W +V+ ++I K+++ DTD N + E+N + E N N EE E EE+ D N
Sbjct: 351 WKFSVIQDLIQKEINSKDTDSENEQ-EQNNDDEEHNSNNEE--------EQEEHNDNNEE 401

Query: 264 QDEN 253
Q+EN
Sbjct: 402 QEEN 405


>tr|Q5A892|Q5A892_CANAL Potential ubiquitin-protein ligase
OS=Candida albicans GN=UFD4 PE=4 SV=1
Length = 1711

Score = 37.7 bits (86), Expect = 0.29
Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 3/72 (4%)
Frame = -1

Query: 432 NVVFEVIKQVSVTDTDDSNVRLEENPESNEFNGNQEEALDYIDFDESEEYIDLNVSQDEN 253
++V + V D D + +EEN E + + +QE+ DY D DE +E +D +DE+
Sbjct: 696 SIVIKEFASVESNDDDMVSTDVEENEELGQASTSQEDEDDYDDEDEDDEVVD----EDED 751

Query: 252 PEYV---SRSTS 226
E+ SR TS
Sbjct: 752 EEFSILDSRGTS 763


>tr|Q8T1D9|Q8T1D9_DICDI Putative uncharacterized protein
OS=Dictyostelium discoideum GN=DDB_0167316 PE=4 SV=2
Length = 693

Score = 36.2 bits (82), Expect = 0.84
Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
Frame = -1

Query: 426 VFEVIKQVSVTDTDDSNVRLEENPESNEFNGNQ--EEALDYIDFDESEEYIDLNVSQDEN 253
V E +++ + ++ V E+ E E N N+ EE ++ D DES +++D N+ D+
Sbjct: 331 VDEELQEEGEEEEEEEEVEEEDAQEEQEDNANEGEEEEEEFEDIDESNQHVDSNIEVDDE 390

Query: 252 PEYVS 238
+V+
Sbjct: 391 DAHVN 395


>tr|A8NR32|A8NR32_BRUMA Putative uncharacterized protein OS=Brugia
malayi GN=Bm1_07985 PE=4 SV=1
Length = 450

Score = 35.4 bits (80), Expect = 1.4
Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 2/65 (3%)
Frame = -1

Query: 435 VNVVFE--VIKQVSVTDTDDSNVRLEENPESNEFNGNQEEALDYIDFDESEEYIDLNVSQ 262
VNV E V +V+VT + S+ N ESNE N+E + + DE EE D VS
Sbjct: 276 VNVTSEENVTSEVNVTSEESSSEENVTNEESNEDEENEESGSETDEEDEDEE--DNKVSS 333

Query: 261 DENPE 247
DE+ +
Sbjct: 334 DEDDD 338


>tr|B4JGX2|B4JGX2_DROGR GH19501 OS=Drosophila grimshawi GN=GH19501
PE=4 SV=1
Length = 885

Score = 34.7 bits (78), Expect = 2.5
Identities = 20/70 (28%), Positives = 32/70 (45%)
Frame = -1

Query: 420 EVIKQVSVTDTDDSNVRLEENPESNEFNGNQEEALDYIDFDESEEYIDLNVSQDENPEYV 241
E +KQ TD D+ NV + ESN N+ + + E +E +L + P Y
Sbjct: 11 EQVKQDKNTDADEENVEMRAGEESNAAMPNKTDEQKTEEEQERQEVKELQTVDRQEPIYE 70

Query: 240 SRSTSIGFSE 211
+ S+SI +
Sbjct: 71 NISSSISIQQ 80


>tr|A3GFZ3|A3GFZ3_PICST Putative uncharacterized protein FKH3
OS=Pichia stipitis GN=FKH3 PE=4 SV=1
Length = 270

Score = 34.7 bits (78), Expect = 2.5
Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
Frame = -1

Query: 438 PVNVVFEVIKQVSVTDTDDSNVRLEENPESNEFNGNQEEALDY-IDFDESEEYIDLNVSQ 262
P ++ K S +D DD N +E+ + N +N N + ++ I+ D E+ I V +
Sbjct: 68 PTDLTTSSPKSRSKSDEDDDNDVFDEHNDDNTYNNNNNDTINTDINIDNEEQMI--KVKE 125

Query: 261 DENPEYVSRST 229
+E + VS ST
Sbjct: 126 NETEDSVSAST 136


>tr|Q3YT86|Q3YT86_EHRCJ TRAG protein OS=Ehrlichia canis (strain
Jake) GN=Ecaj_0018 PE=4 SV=1
Length = 723

Score = 34.3 bits (77), Expect = 3.2
Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 5/69 (7%)
Frame = -1

Query: 420 EVIKQVSVTDTDDSNVRLEE-NPE----SNEFNGNQEEALDYIDFDESEEYIDLNVSQDE 256
E + D ++SN EE NPE SN + +EE + ID+++ EEY D +D+
Sbjct: 645 EEYDDIDYDDNNNSNEEYEEDNPEEDDNSNNLDDEEEEEDNIIDYEDEEEYDDNIDYKDD 704

Query: 255 NPEYVSRST 229
+ Y +T
Sbjct: 705 DNNYNKDTT 713