BP918607
Clone id YMU001_000115_D12
Library
Length 521
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000115_D12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCCTCTTGAATTTGTGCACAGGGTCCTCGAAATGGAAGGCAATTCTCATCATGATGACTC
GGATAATCAAGCTGCCGTGAGACAAGAGGTACAAAAACTGGAAGTGGCTTGTGCTGAGTT
GAAAAGTTTACCTCCTATGAGAAGTGTGTATCACAAACGAGGTGCTCTTTTTTTCCAAAG
CGACGTTAAGACACTCACAAGTTTGCATCAGAAGGAGCTGGAAAAGGCAAAGACTCGCTT
AAGGTGAATTTCTACAAGAGCGTGTTCTTGCAGGCAGCTAAACCGGGAAGGATTTTTGTG
AAGGTGGTACTAGAAGCAATATGTAACAGTTTATGTTGTCATTTGCTGGTACCTGGGTAC
CAAAGGTTTATGATGTGAAACTTGTACACCTGCATTGCTCAAGGCACACCTTATGTCATT
TTAATCTAGTGTTTCTGTTTTGTATGGTTGAGAGAAAGGAGCATTATTGCCTGTGTCTTG
TCAATGGTCACATTTCAAAGCGCAAAAACTGTCATTGTATG
■■Homology search results ■■ -
sp_hit_id P24136
Definition sp|P24136|OPPD_BACSU Oligopeptide transport ATP-binding protein oppD OS=Bacillus subtilis
Align length 64
Score (bit) 31.2
E-value 3.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918607|Adiantum capillus-veneris mRNA, clone:
YMU001_000115_D12.
(521 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P24136|OPPD_BACSU Oligopeptide transport ATP-binding protein ... 31 3.1
sp|Q5H9K5|ZMAT1_HUMAN Zinc finger matrin-type protein 1 OS=Homo ... 30 5.3
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 ... 30 6.9

>sp|P24136|OPPD_BACSU Oligopeptide transport ATP-binding protein
oppD OS=Bacillus subtilis GN=oppD PE=3 SV=2
Length = 358

Score = 31.2 bits (69), Expect = 3.1
Identities = 19/64 (29%), Positives = 28/64 (43%)
Frame = +2

Query: 41 NSHHDDSDNQAAVRQEVQKLEVACAELKSLPPMRSVYHKRGALFFQSDVKTLTSLHQKEL 220
N H D + A V + V + L PM Y KRG + F+ K L L +KE+
Sbjct: 31 NFHLDKGETLAIVGESGSGKSVTSQAIMKLIPMPPGYFKRGEILFEG--KDLVPLSEKEM 88

Query: 221 EKAK 232
+ +
Sbjct: 89 QNVR 92


>sp|Q5H9K5|ZMAT1_HUMAN Zinc finger matrin-type protein 1 OS=Homo
sapiens GN=ZMAT1 PE=2 SV=1
Length = 638

Score = 30.4 bits (67), Expect = 5.3
Identities = 17/67 (25%), Positives = 35/67 (52%)
Frame = +2

Query: 41 NSHHDDSDNQAAVRQEVQKLEVACAELKSLPPMRSVYHKRGALFFQSDVKTLTSLHQKEL 220
+S ++ +D+QA +Q+ QK + E K P HKR + +D+ S+ Q++
Sbjct: 522 SSENNTADHQAGHKQKHQKRKRHLEEGKERPEKEQSKHKRKKSYEDTDLDKDKSIRQRKR 581

Query: 221 EKAKTRL 241
E+ + ++
Sbjct: 582 EEDRVKV 588


>sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40
OS=Danio rerio GN=lrrc40 PE=2 SV=1
Length = 601

Score = 30.0 bits (66), Expect = 6.9
Identities = 14/32 (43%), Positives = 20/32 (62%)
Frame = +2

Query: 41 NSHHDDSDNQAAVRQEVQKLEVACAELKSLPP 136
N+H D A Q + KL+++C +LKSLPP
Sbjct: 181 NNHLIDIPESLANLQNLVKLDLSCNKLKSLPP 212


tr_hit_id B6TIM1
Definition tr|B6TIM1|B6TIM1_MAIZE Putative uncharacterized protein OS=Zea mays
Align length 68
Score (bit) 54.3
E-value 4.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918607|Adiantum capillus-veneris mRNA, clone:
YMU001_000115_D12.
(521 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6TIM1|B6TIM1_MAIZE Putative uncharacterized protein OS=Zea m... 54 4e-06
tr|B6UE39|B6UE39_MAIZE Putative uncharacterized protein OS=Zea m... 54 6e-06
tr|A9PCN0|A9PCN0_POPTR Putative uncharacterized protein OS=Popul... 46 0.001
tr|Q8LD83|Q8LD83_ARATH Putative uncharacterized protein (At1g492... 45 0.002
tr|B8B5Q6|B8B5Q6_ORYSI Putative uncharacterized protein OS=Oryza... 43 0.008
tr|B6UF99|B6UF99_MAIZE Putative uncharacterized protein OS=Zea m... 40 0.090
tr|B5MCH6|B5MCH6_HUMAN Putative uncharacterized protein ENSP0000... 33 6.5
tr|B2AUB2|B2AUB2_PODAN Predicted CDS Pa_1_18540 OS=Podospora ans... 33 8.5

>tr|B6TIM1|B6TIM1_MAIZE Putative uncharacterized protein OS=Zea mays
PE=4 SV=1
Length = 99

Score = 54.3 bits (129), Expect = 4e-06
Identities = 26/68 (38%), Positives = 43/68 (63%)
Frame = +2

Query: 62 DNQAAVRQEVQKLEVACAELKSLPPMRSVYHKRGALFFQSDVKTLTSLHQKELEKAKTRL 241
+ + + +E++ EVA AEL +L P R+VY K G +FF+ VK++ + QK+L++AK RL
Sbjct: 16 EKKVELLKEIRAHEVAIAELDNLNPSRAVYQKAGNIFFRKSVKSVITTEQKQLDQAKARL 75

Query: 242 R*ISTRAC 265
+ C
Sbjct: 76 SKLPLSLC 83


>tr|B6UE39|B6UE39_MAIZE Putative uncharacterized protein OS=Zea mays
PE=4 SV=1
Length = 79

Score = 53.5 bits (127), Expect = 6e-06
Identities = 25/60 (41%), Positives = 41/60 (68%)
Frame = +2

Query: 62 DNQAAVRQEVQKLEVACAELKSLPPMRSVYHKRGALFFQSDVKTLTSLHQKELEKAKTRL 241
+ + + +E++ EVA AEL +L P R+VY K G +FF+ VK++ + QK+L++AK RL
Sbjct: 16 EKKVELLKEIRAHEVAIAELDNLNPSRAVYQKAGNIFFRKSVKSVITTEQKQLDQAKARL 75


>tr|A9PCN0|A9PCN0_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=4 SV=1
Length = 70

Score = 46.2 bits (108), Expect = 0.001
Identities = 23/53 (43%), Positives = 35/53 (66%)
Frame = +2

Query: 83 QEVQKLEVACAELKSLPPMRSVYHKRGALFFQSDVKTLTSLHQKELEKAKTRL 241
++V+ EVA AEL +L R+VY K G LFF++ + T+ QK+L+ AK +L
Sbjct: 16 KKVRSHEVAIAELSNLSSSRTVYQKNGNLFFRTTSQKATASEQKQLDSAKAKL 68


>tr|Q8LD83|Q8LD83_ARATH Putative uncharacterized protein (At1g49245)
OS=Arabidopsis thaliana PE=4 SV=1
Length = 74

Score = 45.1 bits (105), Expect = 0.002
Identities = 23/67 (34%), Positives = 39/67 (58%)
Frame = +2

Query: 59 SDNQAAVRQEVQKLEVACAELKSLPPMRSVYHKRGALFFQSDVKTLTSLHQKELEKAKTR 238
SD + + +E+++ EV+ EL SL RS+Y K G LFF + + QK+L+ AK+
Sbjct: 7 SDREFELEKEIKRQEVSLDELSSLSSSRSIYQKNGNLFFLTSAEKAKISAQKQLDYAKSE 66

Query: 239 LR*ISTR 259
+ I ++
Sbjct: 67 INKIRSQ 73


>tr|B8B5Q6|B8B5Q6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_25859 PE=4 SV=1
Length = 98

Score = 43.1 bits (100), Expect = 0.008
Identities = 20/53 (37%), Positives = 32/53 (60%)
Frame = +2

Query: 62 DNQAAVRQEVQKLEVACAELKSLPPMRSVYHKRGALFFQSDVKTLTSLHQKEL 220
D + + +E++ EVA EL +LPP R+VY K LFF+ VK+ + Q+ +
Sbjct: 14 DKKVQLMKEIRAHEVAIGELNNLPPSRAVYQKTCNLFFRKSVKSAVTSEQRSV 66


>tr|B6UF99|B6UF99_MAIZE Putative uncharacterized protein OS=Zea mays
PE=4 SV=1
Length = 85

Score = 39.7 bits (91), Expect = 0.090
Identities = 19/50 (38%), Positives = 31/50 (62%)
Frame = +2

Query: 62 DNQAAVRQEVQKLEVACAELKSLPPMRSVYHKRGALFFQSDVKTLTSLHQ 211
+ + + +E++ EVA AEL +L P R+VY K G +FF VK++ + Q
Sbjct: 16 EKKVELLKEIRAHEVAIAELDNLNPSRAVYQKAGNIFFCKSVKSVITTEQ 65


>tr|B5MCH6|B5MCH6_HUMAN Putative uncharacterized protein
ENSP00000384896 OS=Homo sapiens PE=4 SV=1
Length = 451

Score = 33.5 bits (75), Expect = 6.5
Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 5/58 (8%)
Frame = +3

Query: 333 MLSFAGTWVPKVYDVKLVHLHCS-----RHTLCHFNLVFLFCMVERKEHYCLCLVNGH 491
M+SF + + ++ VH+HCS R+ H + L R+EH C+C H
Sbjct: 108 MVSFIAVYTSHISKIEQVHIHCSCPGIERYLHNHNYAITLQLRCYRREHICVCRSKKH 165


>tr|B2AUB2|B2AUB2_PODAN Predicted CDS Pa_1_18540 OS=Podospora
anserina PE=4 SV=1
Length = 119

Score = 33.1 bits (74), Expect = 8.5
Identities = 18/63 (28%), Positives = 35/63 (55%)
Frame = +2

Query: 71 AAVRQEVQKLEVACAELKSLPPMRSVYHKRGALFFQSDVKTLTSLHQKELEKAKTRLR*I 250
A+ ++E++ ++ +E+ SLPP +VY G +F V TL ++++ +T L +
Sbjct: 34 ASKQREMRLAQLTRSEISSLPPDTAVYEGVGKMFVGLPVPTLQEKLSSQVKENETELEAL 93

Query: 251 STR 259
S R
Sbjct: 94 SKR 96