BP918608
Clone id YMU001_000115_E01
Library
Length 281
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000115_E01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATCTGTAGAATGTTCTGAACCATTTGTAAGAAGAGGAATAGACGGAGGCATTGTCTGCAT
CCTATGAGGCATGTCGTGGTCACTGGCGCGTCCATAACTCATGTGCCCTTGGAGCATGGC
TTCGGCAATATGCAGACTGTCATGTGCCCCATGTTGAGCATACTCAAATTCGTTTTCAAG
GTCATCTGCACCATCTACCTCTTCATCACCTTGCACTCTTGCACTCCCTTTAAGCCTTTA
GTATCTGGTCCTACATTGAGGACAGACCTGGTTGCCATCCT
■■Homology search results ■■ -
sp_hit_id Q851L8
Definition sp|Q851L8|CESA5_ORYSJ Probable cellulose synthase A catalytic subunit 5 [UDP-forming] OS=Oryza sativa subsp. japonica
Align length 88
Score (bit) 97.1
E-value 2.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918608|Adiantum capillus-veneris mRNA, clone:
YMU001_000115_E01.
(281 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q851L8|CESA5_ORYSJ Probable cellulose synthase A catalytic su... 97 2e-20
sp|A2XNT2|CESA5_ORYSI Probable cellulose synthase A catalytic su... 97 2e-20
sp|Q69V23|CESA3_ORYSJ Probable cellulose synthase A catalytic su... 91 2e-18
sp|Q6YVM4|CESA6_ORYSJ Probable cellulose synthase A catalytic su... 84 3e-16
sp|Q94JQ6|CESA6_ARATH Cellulose synthase A catalytic subunit 6 [... 77 2e-14
sp|Q69P51|CESA9_ORYSJ Cellulose synthase A catalytic subunit 9 [... 76 5e-14
sp|A2Z1C8|CESA9_ORYSI Cellulose synthase A catalytic subunit 9 [... 76 5e-14
sp|Q9SWW6|CESA7_ARATH Cellulose synthase A catalytic subunit 7 [... 76 5e-14
sp|Q8L778|CESA5_ARATH Cellulose synthase A catalytic subunit 5 [... 73 5e-13
sp|Q9SJ22|CESA9_ARATH Probable cellulose synthase A catalytic su... 71 1e-12
sp|O48947|CESA2_ARATH Cellulose synthase A catalytic subunit 2 [... 69 7e-12
sp|O48946|CESA1_ARATH Cellulose synthase A catalytic subunit 1 [... 69 7e-12
sp|Q6AT26|CESA1_ORYSJ Probable cellulose synthase A catalytic su... 66 6e-11
sp|A2Y0X2|CESA1_ORYSI Probable cellulose synthase A catalytic su... 66 6e-11
sp|Q941L0|CESA3_ARATH Cellulose synthase A catalytic subunit 3 [... 61 2e-09
sp|Q84M43|CESA2_ORYSJ Probable cellulose synthase A catalytic su... 57 4e-08
sp|A2XN66|CESA2_ORYSI Probable cellulose synthase A catalytic su... 57 4e-08
sp|Q9SKJ5|CESAA_ARATH Probable cellulose synthase A catalytic su... 55 8e-08
sp|Q84ZN6|CESA8_ORYSJ Probable cellulose synthase A catalytic su... 51 2e-06
sp|Q84JA6|CESA4_ARATH Cellulose synthase A catalytic subunit 4 [... 50 3e-06
sp|Q9AV71|CESA7_ORYSJ Cellulose synthase A catalytic subunit 7 [... 49 8e-06
sp|O88444|ADCY1_MOUSE Adenylate cyclase type 1 OS=Mus musculus G... 32 1.3
sp|P52217|GRDB_CLOLI Glycine reductase complex component B subun... 31 2.2
sp|Q6AHF2|HEMH_LEIXX Ferrochelatase OS=Leifsonia xyli subsp. xyl... 29 6.4
sp|P19754|ADCY1_BOVIN Adenylate cyclase type 1 OS=Bos taurus GN=... 29 6.4
sp|Q08828|ADCY1_HUMAN Adenylate cyclase type 1 OS=Homo sapiens G... 29 8.3

>sp|Q851L8|CESA5_ORYSJ Probable cellulose synthase A catalytic
subunit 5 [UDP-forming] OS=Oryza sativa subsp. japonica
GN=CESA5 PE=2 SV=1
Length = 1092

Score = 97.1 bits (240), Expect = 2e-20
Identities = 50/88 (56%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSLHIAEAMLQGHM 100
+G Q CPQC+TR+ RLKG ARV GDEE + DDLENEF + DS ++AE+ML GHM
Sbjct: 76 EGTQNCPQCKTRFKRLKGCARVPGDEEEEDVDDLENEFNW--RDKTDSQYVAESMLHGHM 133

Query: 99 SYGRASDHD-MPHRMQTMPPSIPLLTNG 19
SYGR D D +P Q + P++PLLTNG
Sbjct: 134 SYGRGGDLDGVPQHFQPI-PNVPLLTNG 160


>sp|A2XNT2|CESA5_ORYSI Probable cellulose synthase A catalytic
subunit 5 [UDP-forming] OS=Oryza sativa subsp. indica
GN=CESA5 PE=2 SV=1
Length = 1092

Score = 97.1 bits (240), Expect = 2e-20
Identities = 50/88 (56%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSLHIAEAMLQGHM 100
+G Q CPQC+TR+ RLKG ARV GDEE + DDLENEF + DS ++AE+ML GHM
Sbjct: 76 EGTQNCPQCKTRFKRLKGCARVPGDEEEEDVDDLENEFNW--RDKTDSQYVAESMLHGHM 133

Query: 99 SYGRASDHD-MPHRMQTMPPSIPLLTNG 19
SYGR D D +P Q + P++PLLTNG
Sbjct: 134 SYGRGGDLDGVPQHFQPI-PNVPLLTNG 160


>sp|Q69V23|CESA3_ORYSJ Probable cellulose synthase A catalytic
subunit 3 [UDP-forming] OS=Oryza sativa subsp. japonica
GN=CESA3 PE=2 SV=1
Length = 1093

Score = 90.5 bits (223), Expect = 2e-18
Identities = 47/89 (52%), Positives = 61/89 (68%), Gaps = 2/89 (2%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSLHIAEAMLQGHM 100
+G Q CPQC+TR+ RL+G ARV GDEE DG DDLENEF + +DS ++AE+ML HM
Sbjct: 76 EGTQNCPQCKTRFKRLRGCARVPGDEEEDGVDDLENEFNWRDR--NDSQYVAESMLHAHM 133

Query: 99 SYGR--ASDHDMPHRMQTMPPSIPLLTNG 19
SYGR + +P Q P++PLLT+G
Sbjct: 134 SYGRGGVDVNGVPQPFQP-NPNVPLLTDG 161


>sp|Q6YVM4|CESA6_ORYSJ Probable cellulose synthase A catalytic
subunit 6 [UDP-forming] OS=Oryza sativa subsp. japonica
GN=CESA6 PE=2 SV=1
Length = 1092

Score = 83.6 bits (205), Expect = 3e-16
Identities = 45/87 (51%), Positives = 56/87 (64%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSLHIAEAMLQGHM 100
+G+Q CPQC+TR+ RLKG RV GDEE DG DDLE EF D +IAE+ML+ +M
Sbjct: 79 EGSQACPQCKTRFKRLKGCPRVAGDEEEDGVDDLEGEFG-LDGREDDPQYIAESMLRANM 137

Query: 99 SYGRASDHDMPHRMQTMPPSIPLLTNG 19
SYGR D + P++PLLTNG
Sbjct: 138 SYGRGGDLQPFQPI----PNVPLLTNG 160


>sp|Q94JQ6|CESA6_ARATH Cellulose synthase A catalytic subunit 6
[UDP-forming] OS=Arabidopsis thaliana GN=CESA6 PE=1 SV=2
Length = 1084

Score = 77.4 bits (189), Expect = 2e-14
Identities = 43/91 (47%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSLHIAEAMLQGHM 100
+GNQ CPQC+TR+ RLKGS RV+GDEE D DDL+NEFEY +G I + M
Sbjct: 76 EGNQACPQCKTRFKRLKGSPRVEGDEEEDDIDDLDNEFEYGNNG------IGFDQVSEGM 129

Query: 99 SYGRASDHDMPHRMQTMPP--SIPLLTNGSE 13
S R + + + PP IPLLT G E
Sbjct: 130 SISRRNSGFPQSDLDSAPPGSQIPLLTYGDE 160


>sp|Q69P51|CESA9_ORYSJ Cellulose synthase A catalytic subunit 9
[UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA9
PE=2 SV=1
Length = 1055

Score = 76.3 bits (186), Expect = 5e-14
Identities = 45/91 (49%), Positives = 53/91 (58%), Gaps = 10/91 (10%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEF----------EYAQHGAHDSLH 130
+G Q CPQC+TRY RLKGS RV GDE+ + DDLE+EF + Q G +S H
Sbjct: 74 EGTQNCPQCKTRYKRLKGSPRVPGDEDEEDIDDLEHEFNIDDEKQKQLQQDQDGMQNS-H 132

Query: 129 IAEAMLQGHMSYGRASDHDMPHRMQTMPPSI 37
I EAML G MSYGR D D +PP I
Sbjct: 133 ITEAMLHGKMSYGRGPD-DGDGNSTPLPPII 162


>sp|A2Z1C8|CESA9_ORYSI Cellulose synthase A catalytic subunit 9
[UDP-forming] OS=Oryza sativa subsp. indica GN=CESA9
PE=2 SV=1
Length = 1055

Score = 76.3 bits (186), Expect = 5e-14
Identities = 45/91 (49%), Positives = 53/91 (58%), Gaps = 10/91 (10%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEF----------EYAQHGAHDSLH 130
+G Q CPQC+TRY RLKGS RV GDE+ + DDLE+EF + Q G +S H
Sbjct: 74 EGTQNCPQCKTRYKRLKGSPRVPGDEDEEDIDDLEHEFNIDDEKQKQLQQDQDGMQNS-H 132

Query: 129 IAEAMLQGHMSYGRASDHDMPHRMQTMPPSI 37
I EAML G MSYGR D D +PP I
Sbjct: 133 ITEAMLHGKMSYGRGPD-DGDGNSTPLPPII 162


>sp|Q9SWW6|CESA7_ARATH Cellulose synthase A catalytic subunit 7
[UDP-forming] OS=Arabidopsis thaliana GN=CESA7 PE=1 SV=1
Length = 1026

Score = 76.3 bits (186), Expect = 5e-14
Identities = 41/81 (50%), Positives = 50/81 (61%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSLHIAEAMLQGHM 100
+G Q CPQC+TRY RL+GS RV+GDE+ + DD+E EF +H H AEAML G M
Sbjct: 74 EGTQNCPQCKTRYKRLRGSPRVEGDEDEEDIDDIEYEFN-IEHEQDKHKHSAEAMLYGKM 132

Query: 99 SYGRASDHDMPHRMQTMPPSI 37
SYGR + D R PP I
Sbjct: 133 SYGRGPEDDENGR---FPPVI 150


>sp|Q8L778|CESA5_ARATH Cellulose synthase A catalytic subunit 5
[UDP-forming] OS=Arabidopsis thaliana GN=CESA5 PE=1 SV=2
Length = 1069

Score = 72.8 bits (177), Expect = 5e-13
Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSLHIAEAMLQGHM 100
+GNQ CPQC+TRY R+KGS RV+GDEE DG DDL+ EF+Y++ G L+
Sbjct: 76 EGNQSCPQCKTRYKRIKGSPRVEGDEEDDGIDDLDFEFDYSRSG-----------LESET 124

Query: 99 SYGRASDHDMPHRMQTMPP--SIPLLTNGSE 13
R S+ D + + PP IPLLT G E
Sbjct: 125 FSRRNSEFD----LASAPPGSQIPLLTYGEE 151


>sp|Q9SJ22|CESA9_ARATH Probable cellulose synthase A catalytic
subunit 9 [UDP-forming] OS=Arabidopsis thaliana GN=CESA9
PE=2 SV=1
Length = 1088

Score = 71.2 bits (173), Expect = 1e-12
Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSLHIAEAML-QGH 103
+GNQ CPQC TRY R+KGS RV+GDEE D DDLE+EF D H+ EA L
Sbjct: 76 EGNQACPQCGTRYKRIKGSPRVEGDEEDDDIDDLEHEFY-----GMDPEHVTEAALYYMR 130

Query: 102 MSYGRASDHDMPHRMQTMPPS-IPLLTNGSEHS 7
++ GR +D ++ H P S +PLLT E S
Sbjct: 131 LNTGRGTD-EVSHLYSASPGSEVPLLTYCDEDS 162


tr_hit_id A7P8V1
Definition tr|A7P8V1|A7P8V1_VITVI Chromosome chr3 scaffold_8, whole genome shotgun sequence OS=Vitis vinifera
Align length 89
Score (bit) 110.0
E-value 4.0e-23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918608|Adiantum capillus-veneris mRNA, clone:
YMU001_000115_E01.
(281 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7P8V1|A7P8V1_VITVI Chromosome chr3 scaffold_8, whole genome ... 110 4e-23
tr|A7QPK7|A7QPK7_VITVI Chromosome chr18 scaffold_137, whole geno... 110 5e-23
tr|Q9LLI3|Q9LLI3_MAIZE Cellulose synthase-7 OS=Zea mays GN=CesA-... 100 3e-20
tr|B8XPP7|B8XPP7_9ROSI Cellulose synthase OS=Betula luminifera G... 100 4e-20
tr|Q6S352|Q6S352_HORVU Putative cellulose synthase catalytic sub... 100 5e-20
tr|Q9LLI4|Q9LLI4_MAIZE Cellulose synthase-6 OS=Zea mays GN=CesA-... 99 8e-20
tr|Q2IB38|Q2IB38_EUCGR Cellulose synthase 6 OS=Eucalyptus grandi... 99 8e-20
tr|B8Y8U1|B8Y8U1_BAMOL Cellulose synthase CesA10 (Fragment) OS=B... 98 2e-19
tr|Q06FC9|Q06FC9_PHYPA Cellulose synthase 5 OS=Physcomitrella pa... 97 4e-19
tr|A9RUW7|A9RUW7_PHYPA Cellulose synthase 5, glycosyltransferase... 97 4e-19
tr|B8Y8U0|B8Y8U0_BAMOL Cellulose synthase CesA9 (Fragment) OS=Ba... 95 2e-18
tr|Q9LLI2|Q9LLI2_MAIZE Cellulose synthase-8 OS=Zea mays GN=CesA-... 94 4e-18
tr|Q06FC6|Q06FC6_PHYPA Cellulose synthase 8 OS=Physcomitrella pa... 92 2e-17
tr|A9SS88|A9SS88_PHYPA Cellulose synthase 8, glycosyltransferase... 92 2e-17
tr|Q4U0Z3|Q4U0Z3_BAMOL Cellulose synthase BoCesA7 OS=Bambusa old... 91 3e-17
tr|B7F6W2|B7F6W2_ORYSJ cDNA clone:J023086F23, full insert sequen... 91 4e-17
tr|Q4VWW6|Q4VWW6_PINRA Cellulose synthase (Fragment) OS=Pinus ra... 89 1e-16
tr|Q6J8X1|Q6J8X1_9ROSI Cellulose synthase OS=Populus tremula x P... 89 1e-16
tr|A7Q795|A7Q795_VITVI Chromosome chr18 scaffold_59, whole genom... 88 2e-16
tr|Q6XZC2|Q6XZC2_POPTM Cellulose synthase 6 OS=Populus tremuloid... 87 5e-16
tr|Q6YBV3|Q6YBV3_POPTM Cellulose synthase OS=Populus tremuloides... 86 9e-16
tr|A9TE97|A9TE97_PHYPA Cellulose synthase 10, glycosyltransferas... 85 2e-15
tr|Q6J8W8|Q6J8W8_9ROSI Cellulose synthase OS=Populus tremula x P... 85 2e-15
tr|Q06FD0|Q06FD0_PHYPA Cellulose synthase 4 OS=Physcomitrella pa... 84 3e-15
tr|A9SLF9|A9SLF9_PHYPA Cellulose synthase 4, glycosyltransferase... 84 3e-15
tr|Q3Y4F6|Q3Y4F6_PHYPA Cellulose synthase catalytic subunit (Cel... 84 4e-15
tr|Q3Y4F5|Q3Y4F5_PHYPA Cellulose synthase catalytic subunit (Cel... 84 4e-15
tr|Q06FC8|Q06FC8_PHYPA Cellulose synthase 6 OS=Physcomitrella pa... 84 4e-15
tr|Q06FC7|Q06FC7_PHYPA Cellulose synthase 7 OS=Physcomitrella pa... 84 4e-15
tr|B8B4T1|B8B4T1_ORYSI Putative uncharacterized protein OS=Oryza... 84 5e-15

>tr|A7P8V1|A7P8V1_VITVI Chromosome chr3 scaffold_8, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00036318001
PE=4 SV=1
Length = 1094

Score = 110 bits (275), Expect = 4e-23
Identities = 53/89 (59%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYA--QHGAHDSLHIAEAMLQG 106
+GNQVCPQC+TR+ RLKG ARV+GDEE D DDLENEF + + D +IAE MLQG
Sbjct: 77 EGNQVCPQCKTRFKRLKGCARVEGDEEEDDVDDLENEFNFVGRRRDTQDMQYIAEGMLQG 136

Query: 105 HMSYGRASDHDMPHRMQTMPPSIPLLTNG 19
HM+YGRA D DM ++ P++PLLTNG
Sbjct: 137 HMTYGRAGDADMLPQVVNTMPTVPLLTNG 165


>tr|A7QPK7|A7QPK7_VITVI Chromosome chr18 scaffold_137, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00002977001
PE=4 SV=1
Length = 1091

Score = 110 bits (274), Expect = 5e-23
Identities = 54/88 (61%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSL-HIAEAMLQGH 103
+G+QVCPQC+TR+ RLKG ARV+GDEE D DD++NEF + G D +AEAMLQGH
Sbjct: 76 EGSQVCPQCKTRFKRLKGCARVEGDEEEDDIDDVDNEFNFEGRGKVDMQGALAEAMLQGH 135

Query: 102 MSYGRASDHDMPHRMQTMPPSIPLLTNG 19
M+YGRA D D+PH TM P +PLLTNG
Sbjct: 136 MTYGRAYDSDLPHVFHTM-PQVPLLTNG 162


>tr|Q9LLI3|Q9LLI3_MAIZE Cellulose synthase-7 OS=Zea mays GN=CesA-7
PE=2 SV=1
Length = 1086

Score = 100 bits (250), Expect = 3e-20
Identities = 49/87 (56%), Positives = 60/87 (68%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSLHIAEAMLQGHM 100
+G Q CPQC+TRY RLKG RV GDEE DG DDL+NEF + HDS +AE+ML GHM
Sbjct: 76 EGTQNCPQCKTRYKRLKGCQRVTGDEEEDGVDDLDNEFNW---DGHDSQSVAESMLYGHM 132

Query: 99 SYGRASDHDMPHRMQTMPPSIPLLTNG 19
SYGR D + + + P++PLLTNG
Sbjct: 133 SYGRGGDPNGAPQAFQLNPNVPLLTNG 159


>tr|B8XPP7|B8XPP7_9ROSI Cellulose synthase OS=Betula luminifera
GN=CesA5 PE=2 SV=1
Length = 1093

Score = 100 bits (249), Expect = 4e-20
Identities = 53/89 (59%), Positives = 62/89 (69%), Gaps = 2/89 (2%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSLH--IAEAMLQG 106
+GNQVCPQC+TR+ RLKG ARVQGDEE DG DDLENEF + D H A+AML
Sbjct: 76 EGNQVCPQCKTRFKRLKGCARVQGDEEEDGIDDLENEFNFDARTKQDMHHALAADAMLH- 134

Query: 105 HMSYGRASDHDMPHRMQTMPPSIPLLTNG 19
YGRASD D+PH + + P +PLLTNG
Sbjct: 135 ---YGRASDSDLPHVIHS-TPQVPLLTNG 159


>tr|Q6S352|Q6S352_HORVU Putative cellulose synthase catalytic
subunit OS=Hordeum vulgare GN=CesA2 PE=2 SV=1
Length = 1091

Score = 100 bits (248), Expect = 5e-20
Identities = 50/87 (57%), Positives = 60/87 (68%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSLHIAEAMLQGHM 100
+G Q CPQC+TRY RLKG ARV GDEE DGADDLE+EF + DS + AE+ML HM
Sbjct: 76 EGTQNCPQCKTRYKRLKGCARVPGDEEEDGADDLEDEFNWRDR--DDSQYAAESMLHAHM 133

Query: 99 SYGRASDHDMPHRMQTMPPSIPLLTNG 19
+YGR D D H+ P++PLLTNG
Sbjct: 134 TYGRGGDLDGVHQPFQPNPNVPLLTNG 160


>tr|Q9LLI4|Q9LLI4_MAIZE Cellulose synthase-6 OS=Zea mays GN=CesA-6
PE=2 SV=1
Length = 1059

Score = 99.4 bits (246), Expect = 8e-20
Identities = 49/87 (56%), Positives = 61/87 (70%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSLHIAEAMLQGHM 100
+G Q CPQC+TR+ R KG ARV GDEE DG DDLENEF ++ HDS ++AE+ML HM
Sbjct: 46 EGTQNCPQCKTRFKRFKGCARVPGDEEEDGVDDLENEFNWSD--KHDSQYLAESMLHAHM 103

Query: 99 SYGRASDHDMPHRMQTMPPSIPLLTNG 19
SYGR +D D + P++PLLTNG
Sbjct: 104 SYGRGADLDGVPQPFHPIPNVPLLTNG 130


>tr|Q2IB38|Q2IB38_EUCGR Cellulose synthase 6 OS=Eucalyptus grandis
GN=CesA6 PE=2 SV=1
Length = 1097

Score = 99.4 bits (246), Expect = 8e-20
Identities = 52/92 (56%), Positives = 62/92 (67%), Gaps = 5/92 (5%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSL-----HIAEAM 115
+G+Q+CPQC+TR+ RL+G ARV GDEE DG DDLENEF + G H + AEAM
Sbjct: 76 EGSQICPQCKTRFKRLRGCARVDGDEEEDGVDDLENEFNF--DGRHRQEMDRQGYGAEAM 133

Query: 114 LQGHMSYGRASDHDMPHRMQTMPPSIPLLTNG 19
L GHMSYGR SD D+PH P +PLL NG
Sbjct: 134 LHGHMSYGRGSDLDLPHVHPL--PQVPLLANG 163


>tr|B8Y8U1|B8Y8U1_BAMOL Cellulose synthase CesA10 (Fragment)
OS=Bambusa oldhamii PE=2 SV=1
Length = 265

Score = 97.8 bits (242), Expect = 2e-19
Identities = 52/89 (58%), Positives = 63/89 (70%), Gaps = 2/89 (2%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSLHIAEAMLQGHM 100
+G Q CPQCRTR+ RLKG ARV GDEE DG DDLENEF + +DS ++AE+ML HM
Sbjct: 76 EGTQNCPQCRTRFKRLKGCARVPGDEEEDGVDDLENEFNWRDR--NDSQYVAESMLHAHM 133

Query: 99 SYGR--ASDHDMPHRMQTMPPSIPLLTNG 19
SYGR A + MP Q + P++PLLTNG
Sbjct: 134 SYGRGGADLNAMPQPFQPI-PNLPLLTNG 161


>tr|Q06FC9|Q06FC9_PHYPA Cellulose synthase 5 OS=Physcomitrella
patens GN=CesA5 PE=2 SV=1
Length = 1081

Score = 97.1 bits (240), Expect = 4e-19
Identities = 50/93 (53%), Positives = 61/93 (65%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSLHIAEAMLQGHM 100
+GNQ CPQC++RY R KGS RV GDEE D DDLENEF + G D ++ +AML GHM
Sbjct: 75 EGNQSCPQCKSRYNRQKGSPRVPGDEEEDDTDDLENEFA-LEMGQLDEQNVTDAMLHGHM 133

Query: 99 SYGRASDHDMPHRMQTMPPSIPLLTNGSEHSTD 1
SYG DH++P+ QT P PLLT+G D
Sbjct: 134 SYGGNYDHNLPNLHQT--PQFPLLTDGKMGDLD 164


>tr|A9RUW7|A9RUW7_PHYPA Cellulose synthase 5, glycosyltransferase
family 2 OS=Physcomitrella patens subsp. patens GN=cesA5
PE=4 SV=1
Length = 1081

Score = 97.1 bits (240), Expect = 4e-19
Identities = 50/93 (53%), Positives = 61/93 (65%)
Frame = -3

Query: 279 DGNQVCPQCRTRY*RLKGSARVQGDEEVDGADDLENEFEYAQHGAHDSLHIAEAMLQGHM 100
+GNQ CPQC++RY R KGS RV GDEE D DDLENEF + G D ++ +AML GHM
Sbjct: 75 EGNQSCPQCKSRYNRQKGSPRVPGDEEEDDTDDLENEFA-LEMGQLDEQNVTDAMLHGHM 133

Query: 99 SYGRASDHDMPHRMQTMPPSIPLLTNGSEHSTD 1
SYG DH++P+ QT P PLLT+G D
Sbjct: 134 SYGGNYDHNLPNLHQT--PQFPLLTDGKMGDLD 164