BP918644
Clone id YMU001_000115_H02
Library
Length 468
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000115_H02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGCGAATGCAGAGCAGTTATCTGTGTGGCCTTTACCTCTGGTACCAATGAGTTCTCTGAA
GATCCTATCGTCGCTAAGGTGCAAACAGCAAAGGTATTTGACATATACTACTCGCGTCAA
ATTTTCTGTTTGTCCTACCAAGGATTAGTGCTGAAAGAACTGAAAACTCGGTAGAGTTTG
TTGGGTTTAAGTTTTTTGAAATGCATGGCTTTGGGAGGATGTTTTGATGATACTAAACAA
TGTCCAATGGTTATGGGGTATAGTACAGTGAGGAAGGCATGTAAAGTATAAGCTGTATGT
TCTGCTCACCGTAAGCAACATTGGCTTTTGTGGGGCAAGGTATGGAATAGGTTTTAGTAG
GCAAAATGAAGTTTGTAGGGGTGTAGAGATTGTCTGTTAGGTTACTAAAAAAGGAGATGA
ACTGGCTTGGATTATGAAAATGGCTTAGGTTCATGCTGTTCAACCTGT
■■Homology search results ■■ -
sp_hit_id Q6FV36
Definition sp|Q6FV36|MED5_CANGA Mediator of RNA polymerase II transcription subunit 5 OS=Candida glabrata
Align length 77
Score (bit) 31.6
E-value 1.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918644|Adiantum capillus-veneris mRNA, clone:
YMU001_000115_H02.
(468 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6FV36|MED5_CANGA Mediator of RNA polymerase II transcription... 32 1.8
sp|Q6PB75|POLS_MOUSE DNA polymerase sigma OS=Mus musculus GN=Pol... 31 2.3
sp|Q5XG87|POLS_HUMAN DNA polymerase sigma OS=Homo sapiens GN=POL... 31 2.3
sp|Q12RU8|RAPA_SHEDO RNA polymerase-associated protein rapA OS=S... 30 4.0
sp|P20908|CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens ... 30 5.2
sp|A5CW46|TGT_VESOH Queuine tRNA-ribosyltransferase OS=Vesicomyo... 30 6.8

>sp|Q6FV36|MED5_CANGA Mediator of RNA polymerase II transcription
subunit 5 OS=Candida glabrata GN=NUT1 PE=3 SV=1
Length = 1099

Score = 31.6 bits (70), Expect = 1.8
Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 2/77 (2%)
Frame = -3

Query: 463 LNSMNLSHFHNPSQFISFFSNLTDNLYTPTNFILPTKTYSIPCPTKANVA--YGEQNIQL 290
+N L HF + S +FF NLTDNL + I + +PC + N E + +
Sbjct: 121 MNKGILIHFFSKS--CAFFVNLTDNLVI-SQLIKDLRATIVPCILETNFCDISNELVVAI 177

Query: 289 ILYMPSSLYYTP*PLDI 239
++ + L +TP P+ I
Sbjct: 178 AKFLQAVLRFTPQPIQI 194


>sp|Q6PB75|POLS_MOUSE DNA polymerase sigma OS=Mus musculus GN=Pols
PE=2 SV=1
Length = 542

Score = 31.2 bits (69), Expect = 2.3
Identities = 14/35 (40%), Positives = 24/35 (68%)
Frame = +3

Query: 105 ILLASNFLFVLPRISAERTENSVEFVGFKFFEMHG 209
IL+A +FL + PRI A R + ++ + +FFE++G
Sbjct: 157 ILMAISFLQLHPRIDARRADENLGMLLVEFFELYG 191


>sp|Q5XG87|POLS_HUMAN DNA polymerase sigma OS=Homo sapiens GN=POLS
PE=2 SV=2
Length = 542

Score = 31.2 bits (69), Expect = 2.3
Identities = 14/35 (40%), Positives = 24/35 (68%)
Frame = +3

Query: 105 ILLASNFLFVLPRISAERTENSVEFVGFKFFEMHG 209
IL+A +FL + PRI A R + ++ + +FFE++G
Sbjct: 157 ILMAISFLQLHPRIDARRADENLGMLLVEFFELYG 191


>sp|Q12RU8|RAPA_SHEDO RNA polymerase-associated protein rapA
OS=Shewanella denitrificans (strain OS217 / ATCC
BAA-1090 / DSM 15013) GN=rapA PE=3 SV=1
Length = 968

Score = 30.4 bits (67), Expect = 4.0
Identities = 13/35 (37%), Positives = 20/35 (57%)
Frame = -2

Query: 242 HCLVSSKHPPKAMHFKKLKPNKLYRVFSSFSTNPW 138
+ ++S K P+A + L P KLY+ F S S + W
Sbjct: 452 NAMMSGKKTPQAKALEALSPEKLYQAFESDSASWW 486


>sp|P20908|CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens
GN=COL5A1 PE=1 SV=3
Length = 1838

Score = 30.0 bits (66), Expect = 5.2
Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%)
Frame = -3

Query: 367 ILPTKTYSIPCPTKANVAYGEQNIQL--ILYMPSSLYYTP*PLDIV*Y 230
+ PT T + P P + A E+++ + Y+PS YYTP P D + Y
Sbjct: 310 LTPTPTEAAPMPETSEGAGKEEDVGIGDYDYVPSEDYYTPSPYDDLTY 357


>sp|A5CW46|TGT_VESOH Queuine tRNA-ribosyltransferase
OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii
(strain HA) GN=tgt PE=3 SV=1
Length = 370

Score = 29.6 bits (65), Expect = 6.8
Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 3/50 (6%)
Frame = +2

Query: 233 LNNVQWLWGIVQ*GRHVKYKLYVLLTVSNIGFCGARYG---IGFSRQNEV 373
LNN L+GIVQ G H ++ T+ IGF G G +G S++ +
Sbjct: 176 LNNKNALFGIVQGGMHEDLRIQSAATLVEIGFNGFAIGGLSVGESKEEMI 225


tr_hit_id Q886A2
Definition tr|Q886A2|Q886A2_PSESM Transcriptional regulatory protein PhoP, putative OS=Pseudomonas syringae pv. tomato
Align length 109
Score (bit) 34.7
E-value 2.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918644|Adiantum capillus-veneris mRNA, clone:
YMU001_000115_H02.
(468 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q886A2|Q886A2_PSESM Transcriptional regulatory protein PhoP, ... 35 2.5
tr|Q2BX64|Q2BX64_9GAMM Putative uncharacterized protein OS=Photo... 33 9.4
tr|Q1ZW27|Q1ZW27_9VIBR Putative uncharacterized protein OS=Vibri... 33 9.4

>tr|Q886A2|Q886A2_PSESM Transcriptional regulatory protein PhoP,
putative OS=Pseudomonas syringae pv. tomato GN=PSPTO1679
PE=4 SV=1
Length = 225

Score = 34.7 bits (78), Expect = 2.5
Identities = 29/109 (26%), Positives = 48/109 (44%), Gaps = 2/109 (1%)
Frame = -3

Query: 430 PSQFISFFSNLTDNLYTPTNFILPTKTYS--IPCPTKANVAYGEQNIQLILYMPSSLYYT 257
P QF + L L + FI T T + + + A GEQ + L Y L Y
Sbjct: 102 PFQFEELEARLNALLRRSSGFIQSTITAGPLLLDLNRKHAALGEQPLALTAYEYRILEY- 160

Query: 256 P*PLDIV*YHQNILPKPCISKNLNPTNSTEFSVLSALILGRTNRKFDAS 110
++ +HQ ++PK + + L P + + +++GR RK D+S
Sbjct: 161 -----LMLHHQQVVPKERLMEQLYPDDDERDPNVIEVLVGRLRRKLDSS 204


>tr|Q2BX64|Q2BX64_9GAMM Putative uncharacterized protein
OS=Photobacterium sp. SKA34 GN=SKA34_10760 PE=4 SV=1
Length = 190

Score = 32.7 bits (73), Expect = 9.4
Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 9/55 (16%)
Frame = -3

Query: 355 KTYSIPCPTKANVAYGEQNIQLILYMP---------SSLYYTP*PLDIV*YHQNI 218
KTY +P PT AN A+ N L++ P + L Y P +IV QN+
Sbjct: 25 KTYMLPMPTSANTAHNISNKSLLIVRPVEVAAHLAGTGLVYQTSPTEIVEAQQNL 79


>tr|Q1ZW27|Q1ZW27_9VIBR Putative uncharacterized protein OS=Vibrio
angustum S14 GN=VAS14_11239 PE=4 SV=1
Length = 190

Score = 32.7 bits (73), Expect = 9.4
Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 9/55 (16%)
Frame = -3

Query: 355 KTYSIPCPTKANVAYGEQNIQLILYMP---------SSLYYTP*PLDIV*YHQNI 218
KTY +P PT AN A+ N L++ P + L Y P +IV QN+
Sbjct: 25 KTYMLPMPTSANTAHNISNKSLLIVRPVEVAAHLAGTGLVYQTSPTEIVEAQQNL 79