BP918657
Clone id YMU001_000116_A08
Library
Length 592
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000116_A08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CGGGAAACTGCATCACGGGGACGGTGGTCAACGCAAGAATCAGGCACAATATGCAATCCT
TGCAGACAAAGAGGCATTAGGGGAAGCTCTTCATCCCCATCAACAGCAGCATCTCCTCAG
GATATATTAATGAAAATTGGCAGATCATCTGTTTTTGCAGAATGCAGCACATGCAAGGCC
AAGGTCAATAATGGCAGTTTGCTGGCCTCTATATTGCCCCCCAATCGCAGTGCCCCTCCT
AGGGACACAACATCTGGATTTGTAAAGCCGCAGCATAGTTACAGCATGCCTCATAATAGG
CCAACATACGACAAGGGCTTCTTTGGACACAAACCTTACTTTGGTCACAATATGCCCTCT
TACAATGGAATGGGGAGCCACAGCTTTCATGGCAATCCTACTTTCTCTGCACCTTATAAC
TTCCAATATCCCATGGGACCATTCCATGGTGGGGGCTATGGAAACAATGTCAATGGTTAT
GGGCAAATGGCAGGGTCATTCTTTAATAACAATGGCGGTGGATCGAATGCACAAATCCCC
TTCAATGTATTCAATATGGTCAACAATTCAAGTCCCCTTGATATGCTCAAAA
■■Homology search results ■■ -
sp_hit_id P16329
Definition sp|P16329|NO75_PEA Early nodulin-75 (Fragment) OS=Pisum sativum
Align length 84
Score (bit) 36.2
E-value 0.13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918657|Adiantum capillus-veneris mRNA, clone:
YMU001_000116_A08.
(592 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P16329|NO75_PEA Early nodulin-75 (Fragment) OS=Pisum sativum ... 36 0.13
sp|Q6RI45|BRWD3_HUMAN Bromodomain and WD repeat-containing prote... 33 0.82
sp|Q6X5S0|CTL7_ECHPL C-type lectin 7 OS=Echis pyramidum leakeyi ... 32 1.8
sp|Q6X5T4|CTL2_BITAR C-type lectin 2 OS=Bitis arietans PE=2 SV=1 32 1.8
sp|P42583|NKX25_XENLA Homeobox protein Nkx-2.5 OS=Xenopus laevis... 32 1.8
sp|Q6X5S5|CTL27_ECHOC C-type lectin 27 (Fragment) OS=Echis ocell... 32 2.4
sp|P36004|KKQ8_YEAST Probable serine/threonine-protein kinase KK... 32 2.4
sp|A6ZZF6|KKQ8_YEAS7 Probable serine/threonine-protein kinase KK... 32 2.4
sp|Q28H62|CE032_XENTR UPF0467 protein C5orf32 homolog OS=Xenopus... 32 2.4
sp|P35084|RPB1_DICDI DNA-directed RNA polymerase II subunit rpb1... 31 4.1
sp|P13983|EXTN_TOBAC Extensin OS=Nicotiana tabacum GN=HRGPNT3 PE... 31 4.1
sp|A2AHJ4|BRWD3_MOUSE Bromodomain and WD repeat-containing prote... 31 4.1
sp|O52179|SGP2_CHRVI Sulfur globule protein CV2 OS=Chromatium vi... 31 5.3
sp|O59958|CRE1_NEUCR DNA-binding protein cre-1 OS=Neurospora cra... 31 5.3
sp|Q1E0A3|MCA1_COCIM Metacaspase-1 OS=Coccidioides immitis GN=MC... 30 7.0
sp|Q9YGN4|FICB_AGKHB Salmorin subunit B OS=Agkistrodon halys bre... 30 9.0
sp|Q6X5S4|CTL9_ECHCS C-type lectin 9 OS=Echis carinatus sochurek... 30 9.0
sp|Q6X5S1|CTL5_ECHPL C-type lectin 5 OS=Echis pyramidum leakeyi ... 30 9.0
sp|Q8CF97|VCIP1_RAT Deubiquitinating protein VCIP135 OS=Rattus n... 30 9.1
sp|Q8CDG3|VCIP1_MOUSE Deubiquitinating protein VCIP135 OS=Mus mu... 30 9.1
sp|Q96JH7|VCIP1_HUMAN Deubiquitinating protein VCIP135 OS=Homo s... 30 9.1
sp|Q90788|NKX25_CHICK Homeobox protein Nkx-2.5 OS=Gallus gallus ... 30 9.1
sp|Q89AU7|DNAJ_BUCBP Chaperone protein dnaJ OS=Buchnera aphidico... 30 9.1
sp|Q9VVN4|ATRIP_DROME ATR-interacting protein mus304 OS=Drosophi... 30 9.1
sp|Q9LKL2|APRR1_ARATH Two-component response regulator-like APRR... 30 9.1

>sp|P16329|NO75_PEA Early nodulin-75 (Fragment) OS=Pisum sativum
GN=ENOD2 PE=2 SV=1
Length = 112

Score = 36.2 bits (82), Expect = 0.13
Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 7/84 (8%)
Frame = +1

Query: 217 PPNRSAPPRDTTSGFVKPQHS-----YSMPHNRPTYDKGFFGHKPYFGHNMPSYNGMGSH 381
PP+ + PP + KP H Y PH +P ++K ++P H+ P Y
Sbjct: 6 PPHENTPP-EYQPPHEKPPHEHPPPEYQPPHEKPPHEKPSPKYQPPHEHSPPEYQPPHEK 64

Query: 382 SFHGN--PTFSAPYNFQYPMGPFH 447
H N P + PY P +H
Sbjct: 65 PPHENPPPVYKPPYENSPPPHVYH 88


>sp|Q6RI45|BRWD3_HUMAN Bromodomain and WD repeat-containing protein
3 OS=Homo sapiens GN=BRWD3 PE=1 SV=1
Length = 1802

Score = 33.5 bits (75), Expect = 0.82
Identities = 20/68 (29%), Positives = 34/68 (50%)
Frame = +1

Query: 127 LMKIGRSSVFAECSTCKAKVNNGSLLASILPPNRSAPPRDTTSGFVKPQHSYSMPHNRPT 306
L+ +GR S+ + CK+ + NGS A++ +R PP + +VKP + ++ R
Sbjct: 97 LLGVGRQSLLRDAKDCKSTLWNGSAFAAL---HRGRPP-ELPVNYVKPPNVVNITSARQL 152

Query: 307 YDKGFFGH 330
FGH
Sbjct: 153 TGCSRFGH 160


>sp|Q6X5S0|CTL7_ECHPL C-type lectin 7 OS=Echis pyramidum leakeyi
PE=2 SV=1
Length = 148

Score = 32.3 bits (72), Expect = 1.8
Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 7/55 (12%)
Frame = +3

Query: 348 QYALLQWNGEPQLSWQSY----FLCTL*LPISHGTIPWWGL---WKQCQWLWANG 491
QY + NG +S+ + F+ L I + W GL W++CQW W+NG
Sbjct: 53 QYCTEEANGGHLVSFHNRQEVAFVVKLGYTILKADVVWIGLRDFWRECQWEWSNG 107


>sp|Q6X5T4|CTL2_BITAR C-type lectin 2 OS=Bitis arietans PE=2 SV=1
Length = 148

Score = 32.3 bits (72), Expect = 1.8
Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 7/63 (11%)
Frame = +3

Query: 324 WTQTLLWSQYALLQWNGEPQLSWQSY----FLCTL*LPISHGTIPWWGL---WKQCQWLW 482
WT QY Q NG +S+ + F+ L I I W GL W++C W W
Sbjct: 48 WTDA---EQYCTEQENGGHLVSFHNREEVDFVVKLGYTILKADIVWIGLRDFWRECHWGW 104

Query: 483 ANG 491
+NG
Sbjct: 105 SNG 107


>sp|P42583|NKX25_XENLA Homeobox protein Nkx-2.5 OS=Xenopus laevis
GN=nkx-2.5 PE=2 SV=1
Length = 299

Score = 32.3 bits (72), Expect = 1.8
Identities = 29/91 (31%), Positives = 39/91 (42%), Gaps = 1/91 (1%)
Frame = +1

Query: 172 CKAKVNNGSL-LASILPPNRSAPPRDTTSGFVKPQHSYSMPHNRPTYDKGFFGHKPYFGH 348
CK + + +L + + PP R A P G KP S P+N P Y+ PY
Sbjct: 179 CKRQRQDQTLEMVGLPPPRRIAVPVLVRDG--KPCLGESSPYNSP-YNVSI---NPY--- 229

Query: 349 NMPSYNGMGSHSFHGNPTFSAPYNFQYPMGP 441
SYN ++S + NP S YN Y P
Sbjct: 230 ---SYNTYPAYSNYSNPACSGSYNCSYSSMP 257


>sp|Q6X5S5|CTL27_ECHOC C-type lectin 27 (Fragment) OS=Echis
ocellatus PE=2 SV=1
Length = 148

Score = 32.0 bits (71), Expect = 2.4
Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 7/55 (12%)
Frame = +3

Query: 348 QYALLQWNGEPQLSWQSY----FLCTL*LPISHGTIPWWGL---WKQCQWLWANG 491
QY Q NG +S+ + F+ L I I W GL W++C W W+NG
Sbjct: 53 QYCTEQENGGHLVSFHNREEVDFVVKLGYTILKADIVWIGLRDFWRECHWEWSNG 107


>sp|P36004|KKQ8_YEAST Probable serine/threonine-protein kinase KKQ8
OS=Saccharomyces cerevisiae GN=KKQ8 PE=1 SV=2
Length = 724

Score = 32.0 bits (71), Expect = 2.4
Identities = 24/85 (28%), Positives = 34/85 (40%), Gaps = 1/85 (1%)
Frame = +1

Query: 142 RSSVFAECSTCK-AKVNNGSLLASILPPNRSAPPRDTTSGFVKPQHSYSMPHNRPTYDKG 318
RS+V A+ K + + S P S P R T SG N PT +
Sbjct: 62 RSTVSAQILDPKNSPIRQRSYTLKCCTPGLSHPFRQTGSG----------ASNSPTRHRS 111

Query: 319 FFGHKPYFGHNMPSYNGMGSHSFHG 393
G + +++P Y SH+FHG
Sbjct: 112 ISGEEQEIVNSLPEYKRSASHTFHG 136


>sp|A6ZZF6|KKQ8_YEAS7 Probable serine/threonine-protein kinase KKQ8
OS=Saccharomyces cerevisiae (strain YJM789) GN=KKQ8 PE=3
SV=2
Length = 724

Score = 32.0 bits (71), Expect = 2.4
Identities = 24/85 (28%), Positives = 34/85 (40%), Gaps = 1/85 (1%)
Frame = +1

Query: 142 RSSVFAECSTCK-AKVNNGSLLASILPPNRSAPPRDTTSGFVKPQHSYSMPHNRPTYDKG 318
RS+V A+ K + + S P S P R T SG N PT +
Sbjct: 62 RSTVSAQILDPKNSPIRQRSYTLKCCTPGLSHPFRQTGSG----------ASNSPTRHRS 111

Query: 319 FFGHKPYFGHNMPSYNGMGSHSFHG 393
G + +++P Y SH+FHG
Sbjct: 112 ISGEEQEIVNSLPEYKRSASHTFHG 136


>sp|Q28H62|CE032_XENTR UPF0467 protein C5orf32 homolog OS=Xenopus
tropicalis GN=TEgg056l06.1 PE=3 SV=1
Length = 110

Score = 32.0 bits (71), Expect = 2.4
Identities = 20/72 (27%), Positives = 31/72 (43%)
Frame = +1

Query: 217 PPNRSAPPRDTTSGFVKPQHSYSMPHNRPTYDKGFFGHKPYFGHNMPSYNGMGSHSFHGN 396
PP ++PP + + Q SY +P+ P G G++P P Y G + + G
Sbjct: 6 PPPYASPPAPYPP-YGQQQPSYPVPNQYPGNPPGPVGYQPA----QPGYQGYPQYGWQGA 60

Query: 397 PTFSAPYNFQYP 432
P +AP P
Sbjct: 61 PPANAPVYMDAP 72


>sp|P35084|RPB1_DICDI DNA-directed RNA polymerase II subunit rpb1
OS=Dictyostelium discoideum GN=polr2a PE=2 SV=2
Length = 1727

Score = 31.2 bits (69), Expect = 4.1
Identities = 19/73 (26%), Positives = 30/73 (41%)
Frame = +1

Query: 208 SILPPNRSAPPRDTTSGFVKPQHSYSMPHNRPTYDKGFFGHKPYFGHNMPSYNGMGSHSF 387
S P + S P + P +S + P PT + P + + PSY+
Sbjct: 1650 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT-SPSYSPSSPSYSPSSPSYSPSSPSYS 1708

Query: 388 HGNPTFSAPYNFQ 426
+PTF+ YN+Q
Sbjct: 1709 PSSPTFTNKYNYQ 1721


tr_hit_id B2EN97
Definition tr|B2EN97|B2EN97_9BACT Conserved hypothetical membrane spanning protein OS=bacterium Ellin514
Align length 43
Score (bit) 41.2
E-value 0.045
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918657|Adiantum capillus-veneris mRNA, clone:
YMU001_000116_A08.
(592 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B2EN97|B2EN97_9BACT Conserved hypothetical membrane spanning ... 41 0.045
tr|A6RKY1|A6RKY1_BOTFB Putative uncharacterized protein OS=Botry... 39 0.29
tr|Q6C850|Q6C850_YARLI YALI0D22682p OS=Yarrowia lipolytica GN=YA... 37 0.65
tr|Q5B694|Q5B694_EMENI Putative uncharacterized protein OS=Emeri... 37 0.85
tr|A7E458|A7E458_SCLS1 Putative uncharacterized protein OS=Scler... 37 0.85
tr|Q7SDQ7|Q7SDQ7_NEUCR Predicted protein (Related to fibroin-3) ... 37 1.1
tr|B6H975|B6H975_PENCH Pc16g10060 protein OS=Penicillium chrysog... 37 1.1
tr|Q9S9V7|Q9S9V7_ARATH T1N24.15 protein OS=Arabidopsis thaliana ... 36 1.9
tr|Q6DUE1|Q6DUE1_XENLA NK-2 class homeodomain protein OS=Xenopus... 35 4.2
tr|B4HKK8|B4HKK8_DROSE GM25117 OS=Drosophila sechellia GN=GM2511... 35 4.2
tr|Q75CU1|Q75CU1_ASHGO ACL172Cp OS=Ashbya gossypii GN=ACL172C PE... 35 4.2
tr|B6UBI0|B6UBI0_MAIZE RING finger protein 5 OS=Zea mays PE=2 SV=1 34 5.5
tr|B8MRP1|B8MRP1_9EURO Chitin synthase, putative OS=Talaromyces ... 34 7.1
tr|B8M6P4|B8M6P4_9EURO Mn2 homeostasis protein (Per1), putative ... 34 7.1
tr|B6Q767|B6Q767_PENMA Chitin synthase, putative OS=Penicillium ... 34 7.1
tr|P74440|P74440_SYNY3 Slr0408 protein OS=Synechocystis sp. (str... 34 7.2
tr|A9IAC9|A9IAC9_BORPD Transcriptional regulator, AraC family OS... 34 7.2
tr|B7PI37|B7PI37_IXOSC Secreted salivary gland peptide, putative... 34 7.2
tr|B4NI92|B4NI92_DROWI GK13553 OS=Drosophila willistoni GN=GK135... 34 7.2
tr|Q96UR2|Q96UR2_ASPOR Chitin synthase (Fragment) OS=Aspergillus... 33 9.2
tr|Q8TF96|Q8TF96_ASPOR Chitin synthase (Chitin synthase/hyaluron... 33 9.2
tr|B8NGH7|B8NGH7_ASPFL Chitin synthase, putative OS=Aspergillus ... 33 9.2
tr|Q4SWC6|Q4SWC6_TETNG Chromosome undetermined SCAF13634, whole ... 33 9.4
tr|B8BY64|B8BY64_THAPS Predicted protein OS=Thalassiosira pseudo... 33 9.4
tr|Q6QHS3|Q6QHS3_LYTVA Proteoliaisin (Fragment) OS=Lytechinus va... 33 9.4
tr|B7QJ67|B7QJ67_IXOSC Vitellogenin, putative OS=Ixodes scapular... 33 9.4
tr|B3SDM5|B3SDM5_TRIAD Putative uncharacterized protein OS=Trich... 33 9.4
tr|Q4WG38|Q4WG38_ASPFU Putative uncharacterized protein OS=Asper... 33 9.4
tr|B0YC76|B0YC76_ASPFC Putative uncharacterized protein OS=Asper... 33 9.4
tr|A6SFA4|A6SFA4_BOTFB Putative uncharacterized protein OS=Botry... 33 9.4

>tr|B2EN97|B2EN97_9BACT Conserved hypothetical membrane spanning
protein OS=bacterium Ellin514 GN=CflavDRAFT_4179 PE=3
SV=1
Length = 75

Score = 41.2 bits (95), Expect = 0.045
Identities = 16/43 (37%), Positives = 27/43 (62%)
Frame = +1

Query: 304 TYDKGFFGHKPYFGHNMPSYNGMGSHSFHGNPTFSAPYNFQYP 432
+YD+G +G+ Y+G+ S NG H ++ P + PYN++YP
Sbjct: 26 SYDQGGYGNDTYYGYGSASRNG---HYWNNTPAYRYPYNYRYP 65


>tr|A6RKY1|A6RKY1_BOTFB Putative uncharacterized protein
OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_01103
PE=4 SV=1
Length = 536

Score = 38.5 bits (88), Expect = 0.29
Identities = 30/82 (36%), Positives = 38/82 (46%), Gaps = 7/82 (8%)
Frame = +1

Query: 217 PPNRSAPPRDTTSGFVKPQHSYSMP---HNRPTYDKGFFGHKP-YFGHNMPSYNGMGSHS 384
PP S PP T +G P +YS P N+PT F P Y HN+P+ G+ S
Sbjct: 367 PPTDSTPPLPTPTGPSPP--AYSSPPVSPNQPTTQYATFPSNPSYAAHNLPT-PGLFSPG 423

Query: 385 F---HGNPTFSAPYNFQYPMGP 441
F H NP S+P P+ P
Sbjct: 424 FAPQHQNPPISSPAPGLQPLSP 445


>tr|Q6C850|Q6C850_YARLI YALI0D22682p OS=Yarrowia lipolytica
GN=YALI0D22682g PE=4 SV=1
Length = 945

Score = 37.4 bits (85), Expect = 0.65
Identities = 27/96 (28%), Positives = 37/96 (38%), Gaps = 2/96 (2%)
Frame = +1

Query: 157 AECSTCKAKVNNGSLLASILPPNRSAPPRDTTSGFVKPQHSYSMPHNRPTYDKG--FFGH 330
AE K S A + P + P + F PQ + PH++P +G F H
Sbjct: 739 AESRVEKNDSGGSSFQAHVSPQSAPIPQQ-----FGSPQ-GHLQPHSQPFSHQGQEFQSH 792

Query: 331 KPYFGHNMPSYNGMGSHSFHGNPTFSAPYNFQYPMG 438
P +GH P + G F P F + PMG
Sbjct: 793 APQYGHQQPPF---GQQQFQAQPPFGQHFTGSSPMG 825


>tr|Q5B694|Q5B694_EMENI Putative uncharacterized protein
OS=Emericella nidulans GN=AN3936.2 PE=4 SV=1
Length = 387

Score = 37.0 bits (84), Expect = 0.85
Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 4/81 (4%)
Frame = +1

Query: 217 PPNRS-APPRDTTSGFVKP---QHSYSMPHNRPTYDKGFFGHKPYFGHNMPSYNGMGSHS 384
PP+R+ + PR T G++ P + + H ++ G+ H PY H + N HS
Sbjct: 192 PPHRTPSAPRSNTGGYMGPPPIRTAVQNEHFPDSHAHGYDDHNPYDYH---AQNLGRGHS 248

Query: 385 FHGNPTFSAPYNFQYPMGPFH 447
+ N + PY P+G +H
Sbjct: 249 PYDNSPYDQPYTDHSPVGNYH 269


>tr|A7E458|A7E458_SCLS1 Putative uncharacterized protein
OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 /
Ss-1) GN=SS1G_00080 PE=4 SV=1
Length = 435

Score = 37.0 bits (84), Expect = 0.85
Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
Frame = +1

Query: 235 PPRDTTSGFVKPQHSYSMPHNRPTYD-KGFFGHKPYFGHNMPSYNGMGSHSFHGNPTFSA 411
PP+DT QH+ + +P D G+ GH P+ H+ S+NGM ++ G P+ S+
Sbjct: 195 PPQDTLQYSYSSQHTGGAMYTQPRPDWAGYAGHPPHASHHQSSHNGM-NYPVTGAPSQSS 253


>tr|Q7SDQ7|Q7SDQ7_NEUCR Predicted protein (Related to fibroin-3)
OS=Neurospora crassa GN=B10D6.210 PE=4 SV=1
Length = 670

Score = 36.6 bits (83), Expect = 1.1
Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 1/71 (1%)
Frame = +1

Query: 232 APPRDTTSGFVKPQHSYSMPHNRPTYDKGFFGHKPYFGHNMPSYNGMGSHSFHGNPTFSA 411
AP R TT P P+ P + GF+G+ +G N YN S +G + +
Sbjct: 234 APGRGTTPRPSPPPGGQQGPYGGPAGNNGFYGNNNGYGQNAQGYNQASLTSPYGQSSSPS 293

Query: 412 PYNF-QYPMGP 441
PY MGP
Sbjct: 294 PYRMAASAMGP 304


>tr|B6H975|B6H975_PENCH Pc16g10060 protein OS=Penicillium
chrysogenum Wisconsin 54-1255 GN=Pc16g10060 PE=4 SV=1
Length = 455

Score = 36.6 bits (83), Expect = 1.1
Identities = 27/96 (28%), Positives = 33/96 (34%), Gaps = 16/96 (16%)
Frame = +1

Query: 208 SILPPNRSAPPRDTTSGFVKPQHSY-----------SMPHNRPTYDKGFFGHKPYFGHNM 354
S PP AP PQH Y SMP++ +D H H
Sbjct: 2 SYYPPYSGAPGYPPQQPSYPPQHQYPYACLSLCSIESMPNSLTGFDYRQMNH-----HQQ 56

Query: 355 PSYNGMGSHSFHGNPTF-----SAPYNFQYPMGPFH 447
PSY G S+H P S PY + + P H
Sbjct: 57 PSYGGYPGQSYHQQPHHQPPPQSNPYGYSHSSQPSH 92


>tr|Q9S9V7|Q9S9V7_ARATH T1N24.15 protein OS=Arabidopsis thaliana
GN=T1N24.15 PE=4 SV=1
Length = 675

Score = 35.8 bits (81), Expect = 1.9
Identities = 21/78 (26%), Positives = 36/78 (46%)
Frame = +1

Query: 187 NNGSLLASILPPNRSAPPRDTTSGFVKPQHSYSMPHNRPTYDKGFFGHKPYFGHNMPSYN 366
++G L+ S+ + PR S KP + + PHNR ++ G+K +M N
Sbjct: 145 SSGFLIQSLSDSEQDLIPRVQRSARNKPNET-TYPHNRAAFNTTQKGYKSPINGSMDFNN 203

Query: 367 GMGSHSFHGNPTFSAPYN 420
G +F NPT + ++
Sbjct: 204 GFNQAAFQRNPTLQSSFS 221


>tr|Q6DUE1|Q6DUE1_XENLA NK-2 class homeodomain protein OS=Xenopus
laevis GN=Nkx2.5 PE=2 SV=1
Length = 300

Score = 34.7 bits (78), Expect = 4.2
Identities = 30/91 (32%), Positives = 39/91 (42%), Gaps = 1/91 (1%)
Frame = +1

Query: 172 CKAKVNNGSL-LASILPPNRSAPPRDTTSGFVKPQHSYSMPHNRPTYDKGFFGHKPYFGH 348
CK + + +L + + PP R A P G KP S P+N P Y+ PY
Sbjct: 180 CKRQRQDQTLEMVGLPPPRRIAVPVLVRDG--KPCLGESSPYNSP-YNVSI---NPY--- 230

Query: 349 NMPSYNGMGSHSFHGNPTFSAPYNFQYPMGP 441
SYN +HS + NP S YN Y P
Sbjct: 231 ---SYNTYPAHSNYNNPACSGSYNCSYSSMP 258


>tr|B4HKK8|B4HKK8_DROSE GM25117 OS=Drosophila sechellia GN=GM25117
PE=4 SV=1
Length = 2737

Score = 34.7 bits (78), Expect = 4.2
Identities = 25/83 (30%), Positives = 33/83 (39%), Gaps = 8/83 (9%)
Frame = +1

Query: 190 NGSLLASILPPNRSAPPRDTTSGFVKPQHSYSMPHNRPTYDKGFF--------GHKPYFG 345
NG + P PP T GF +P +Y HN P+ + G F G++PY
Sbjct: 1061 NGGYQPPLPPHGGYQPPSQTYGGFQQPNRTYEDFHN-PSQNVGGFQPPYSVKGGYQPYNQ 1119

Query: 346 HNMPSYNGMGSHSFHGNPTFSAP 414
N Y S SF N + P
Sbjct: 1120 LNGGFYQPNQSSSFQSNGGYQPP 1142