BP918660
Clone id YMU001_000116_A11
Library
Length 590
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000116_A11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTTTCAAACTGCCTACATACGTAATCTCATCCATACATACATCCTCTTGCTGCATTCTCT
CTAAATACTTCATTGCTTCACCTCCCAAACCATGTTCCACATGACCGAAGATTAGTGTGT
TCCATAATGCCGCATCTCTGATGAGCAAACTCTCGAACACTTTGCAAGCCTCTGTGAGGG
AACCACATTTGACATACATATCCACTATTGCGTTTCCAACAATACTCTCTCCTTGAAATC
CCTTTTTGACAATGTTGGTGTGAAATTCCCGGCCCTTCTTCACATTTTCCAGAATAGCGC
AAGTTTGTAAACCACAGACCAAAGTGATGGCATTAGCTGTCACACCCTCTGATTGCATCT
GCTGCCAGCAAGCAAGAGCTTTCTCGCCATAACCATGGTCAGCATAGCCTGCAATCATTG
TGTTGCATGAGATCGTATCTCTGACCACTAGACTGTTAAAAAGATTTTCTGCCTCAATAA
ACATGCGGCATCTGGTGTACATATAAATTAGTGCATTGCTCACATACGAGTTCCTTTCAA
TTCCATGCTTAATCACTTTGTCGTGTAACCTTTGGCCATTCTCACTGTCG
■■Homology search results ■■ -
sp_hit_id Q9SY02
Definition sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein At4g02750 OS=Arabidopsis thaliana
Align length 177
Score (bit) 127.0
E-value 3.0e-29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918660|Adiantum capillus-veneris mRNA, clone:
YMU001_000116_A11.
(565 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protei... 127 3e-29
sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protei... 126 9e-29
sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containi... 126 9e-29
sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protei... 125 1e-28
sp|Q8LK93|PP145_ARATH Pentatricopeptide repeat-containing protei... 122 9e-28
sp|Q9LVF9|PP245_ARATH Pentatricopeptide repeat-containing protei... 122 2e-27
sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protei... 121 3e-27
sp|Q0WN60|PPR48_ARATH Pentatricopeptide repeat-containing protei... 120 4e-27
sp|Q9LYV3|PP377_ARATH Putative pentatricopeptide repeat-containi... 120 4e-27
sp|Q9LFL5|PP390_ARATH Putative pentatricopeptide repeat-containi... 119 8e-27
sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protei... 119 1e-26
sp|Q56X05|PPR15_ARATH Pentatricopeptide repeat-containing protei... 119 1e-26
sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protei... 118 2e-26
sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protei... 118 2e-26
sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protei... 118 2e-26
sp|O80647|PP195_ARATH Pentatricopeptide repeat-containing protei... 118 2e-26
sp|Q9FM64|PP431_ARATH Pentatricopeptide repeat-containing protei... 117 4e-26
sp|Q9SI53|PP147_ARATH Pentatricopeptide repeat-containing protei... 117 4e-26
sp|Q9LIC3|PP227_ARATH Putative pentatricopeptide repeat-containi... 116 7e-26
sp|Q9FK33|PP427_ARATH Pentatricopeptide repeat-containing protei... 116 9e-26
sp|Q9LZ19|PP364_ARATH Pentatricopeptide repeat-containing protei... 116 9e-26
sp|Q9SB36|PP337_ARATH Pentatricopeptide repeat-containing protei... 116 9e-26
sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protei... 115 1e-25
sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protei... 115 2e-25
sp|Q9SJG6|PP200_ARATH Pentatricopeptide repeat-containing protei... 115 2e-25
sp|O64705|PP184_ARATH Pentatricopeptide repeat-containing protei... 115 2e-25
sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protei... 114 3e-25
sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protei... 114 4e-25
sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protei... 114 4e-25
sp|Q9SJZ3|PP169_ARATH Pentatricopeptide repeat-containing protei... 114 4e-25

>sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein
At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=2 SV=1
Length = 781

Score = 127 bits (320), Expect = 3e-29
Identities = 66/177 (37%), Positives = 102/177 (57%)
Frame = -1

Query: 535 RNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGEKALACWQQM 356
RN N +I Y +C EA+NLF+ + RD +S MIAGY+ G+ +AL + QM
Sbjct: 341 RNVSTWNTMITGYAQCGKISEAKNLFDKMPKRDPVSWAAMIAGYSQSGHSFEALRLFVQM 400

Query: 355 QSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVKCGSL 176
+ EG N + L TCA + ++ G++ H +VK G++ VGNA++ MY KCGS+
Sbjct: 401 EREGGRLNRSSFSSALSTCADVVALELGKQLHGRLVKGGYETGCFVGNALLLMYCKCGSI 460

Query: 175 TEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEITYVGSL 5
EA +F+ + +D WNT+I G+ HG G A+++ E M++E + D+ T V L
Sbjct: 461 EEANDLFKEMAGKDIVSWNTMIAGYSRHGFGEVALRFFESMKREGLKPDDATMVAVL 517



Score = 102 bits (253), Expect = 2e-21
Identities = 58/161 (36%), Positives = 89/161 (55%), Gaps = 2/161 (1%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +++K G E +V NAL+ MY +C EA +LF + +D +S NTMIAGY+ HG+G
Sbjct: 432 HGRLVKGGYETGCFVGNALLLMYCKCGSIEEANDLFKEMAGKDIVSWNTMIAGYSRHGFG 491

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGRE-FHTNIVKKGFQGESIVGNA 209
E AL ++ M+ EG+ + T+V L C+ V KGR+ F+T G S
Sbjct: 492 EVALRFFESMKREGLKPDDATMVAVLSACSHTGLVDKGRQYFYTMTQDYGVMPNSQHYAC 551

Query: 208 IVDMYVKCGSLTEACKVFESLLIR-DAALWNTLIFGHVEHG 89
+VD+ + G L +A + +++ DAA+W TL+ HG
Sbjct: 552 MVDLLGRAGLLEDAHNLMKNMPFEPDAAIWGTLLGASRVHG 592



Score = 66.2 bits (160), Expect = 1e-10
Identities = 49/168 (29%), Positives = 81/168 (48%), Gaps = 1/168 (0%)
Frame = -1

Query: 538 ERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGEKALACWQQ 359
ER+ N +I Y R R +A LF + RD S NTM++GYA +G + A + + +
Sbjct: 123 ERDLVSWNVMIKGYVRNRNLGKARELFEIMPERDVCSWNTMLSGYAQNGCVDDARSVFDR 182

Query: 358 M-QSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVKCG 182
M + V+ NA+ A ++N K E + K + N ++ +VK
Sbjct: 183 MPEKNDVSWNALL-------SAYVQNSKM--EEACMLFKSRENWALVSWNCLLGGFVKKK 233

Query: 181 SLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDV 38
+ EA + F+S+ +RD WNT+I G+ + G EA + + +DV
Sbjct: 234 KIVEARQFFDSMNVRDVVSWNTIITGYAQSGKIDEARQLFDESPVQDV 281



Score = 62.8 bits (151), Expect = 1e-09
Identities = 41/159 (25%), Positives = 78/159 (49%)
Frame = -1

Query: 517 NALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGEKALACWQQMQSEGVT 338
N L+ + + + +EA F+S+ VRD +S NT+I GYA G ++A +Q+ E
Sbjct: 223 NCLLGGFVKKKKIVEARQFFDSMNVRDVVSWNTIITGYAQSGKIDEA----RQLFDESPV 278

Query: 337 ANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVKCGSLTEACKV 158
+ T + V++ RE + ++ + NA++ YV+ + A ++
Sbjct: 279 QDVFTWTAMVSGYIQNRMVEEARELFDKMPERN----EVSWNAMLAGYVQGERMEMAKEL 334

Query: 157 FESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQED 41
F+ + R+ + WNT+I G+ + G EA ++M + D
Sbjct: 335 FDVMPCRNVSTWNTMITGYAQCGKISEAKNLFDKMPKRD 373



Score = 42.7 bits (99), Expect = 0.001
Identities = 22/73 (30%), Positives = 39/73 (53%)
Frame = -1

Query: 253 IVKKGFQGESIVGNAIVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEA 74
+ K+ + S+ N ++ Y++ G A K+F+ + RD WN +I G+V + G+A
Sbjct: 86 VFKRMPRWSSVSYNGMISGYLRNGEFELARKLFDEMPERDLVSWNVMIKGYVRNRNLGKA 145

Query: 73 MKYLERMQQEDVC 35
+ E M + DVC
Sbjct: 146 RELFEIMPERDVC 158


>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein
At4g18750, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H45 PE=2 SV=1
Length = 871

Score = 126 bits (316), Expect = 9e-29
Identities = 67/188 (35%), Positives = 109/188 (57%), Gaps = 1/188 (0%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H+ + ++ + + +VSNAL+ MY +C EAE +F+ + V+D IS NT+I GY+ + Y
Sbjct: 420 HEWIKENDLGFDIFVSNALMDMYAKCGSMQEAELVFSEMRVKDIISWNTIIGGYSKNCYA 479

Query: 385 EKALACWQQMQSEG-VTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNA 209
+AL+ + + E + + T+ C L CA L KGRE H I++ G+ + V N+
Sbjct: 480 NEALSLFNLLLEEKRFSPDERTVACVLPACASLSAFDKGREIHGYIMRNGYFSDRHVANS 539

Query: 208 IVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMD 29
+VDMY KCG+L A +F+ + +D W +I G+ HG G EA+ +M+Q + D
Sbjct: 540 LVDMYAKCGALLLAHMLFDDIASKDLVSWTVMIAGYGMHGFGKEAIALFNQMRQAGIEAD 599

Query: 28 EITYVGSL 5
EI++V L
Sbjct: 600 EISFVSLL 607



Score = 110 bits (274), Expect = 6e-24
Identities = 61/187 (32%), Positives = 92/187 (49%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++K G + V N+L+ Y + + A +F+ + RD IS N++I GY +G
Sbjct: 218 HGFILKSGFGERNSVGNSLVAFYLKNQRVDSARKVFDEMTERDVISWNSIINGYVSNGLA 277

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
EK L+ + QM G+ + T+V CA + GR H+ VK F E N +
Sbjct: 278 EKGLSVFVQMLVSGIEIDLATIVSVFAGCADSRLISLGRAVHSIGVKACFSREDRFCNTL 337

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+DMY KCG L A VF + R + ++I G+ GL GEA+K E M++E + D
Sbjct: 338 LDMYSKCGDLDSAKAVFREMSDRSVVSYTSMIAGYAREGLAGEAVKLFEEMEEEGISPDV 397

Query: 25 ITYVGSL 5
T L
Sbjct: 398 YTVTAVL 404



Score = 102 bits (254), Expect = 1e-21
Identities = 53/174 (30%), Positives = 90/174 (51%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +K R N L+ MY++C A+ +F + R +S +MIAGYA G
Sbjct: 319 HSIGVKACFSREDRFCNTLLDMYSKCGDLDSAKAVFREMSDRSVVSYTSMIAGYAREGLA 378

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+A+ +++M+ EG++ + T+ L CA + +G+ H I + + V NA+
Sbjct: 379 GEAVKLFEEMEEEGISPDVYTVTAVLNCCARYRLLDEGKRVHEWIKENDLGFDIFVSNAL 438

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQE 44
+DMY KCGS+ EA VF + ++D WNT+I G+ ++ EA+ + +E
Sbjct: 439 MDMYAKCGSMQEAELVFSEMRVKDIISWNTIIGGYSKNCYANEALSLFNLLLEE 492



Score = 89.4 bits (220), Expect = 1e-17
Identities = 52/157 (33%), Positives = 89/157 (56%), Gaps = 3/157 (1%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++++G + +V+N+L+ MY +C + A LF+ + +D +S MIAGY HG+G
Sbjct: 522 HGYIMRNGYFSDRHVANSLVDMYAKCGALLLAHMLFDDIASKDLVSWTVMIAGYGMHGFG 581

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGN-- 212
++A+A + QM+ G+ A+ I+ V L C+ V +G F NI++ + E V +
Sbjct: 582 KEAIALFNQMRQAGIEADEISFVSLLYACSHSGLVDEGWRFF-NIMRHECKIEPTVEHYA 640

Query: 211 AIVDMYVKCGSLTEACKVFESLLI-RDAALWNTLIFG 104
IVDM + G L +A + E++ I DA +W L+ G
Sbjct: 641 CIVDMLARTGDLIKAYRFIENMPIPPDATIWGALLCG 677



Score = 86.3 bits (212), Expect = 1e-16
Identities = 50/178 (28%), Positives = 90/178 (50%)
Frame = -1

Query: 547 HGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGEKALAC 368
+G +S + + L MYT C EA +F+ + + + N ++ A G ++
Sbjct: 123 NGFVIDSNLGSKLSLMYTNCGDLKEASRVFDEVKIEKALFWNILMNELAKSGDFSGSIGL 182

Query: 367 WQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVK 188
+++M S GV ++ T C ++ + L +V G + H I+K GF + VGN++V Y+K
Sbjct: 183 FKKMMSSGVEMDSYTFSCVSKSFSSLRSVHGGEQLHGFILKSGFGERNSVGNSLVAFYLK 242

Query: 187 CGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEITYV 14
+ A KVF+ + RD WN++I G+V +GL + + +M + +D T V
Sbjct: 243 NQRVDSARKVFDEMTERDVISWNSIINGYVSNGLAEKGLSVFVQMLVSGIEIDLATIV 300



Score = 58.5 bits (140), Expect = 2e-08
Identities = 51/187 (27%), Positives = 83/187 (44%), Gaps = 4/187 (2%)
Frame = -1

Query: 565 HDKVIKHGIERNSYV--SNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHG 392
+ K I+ G+ YV + A + + C +++ F+ R NT + + + G
Sbjct: 23 NQKEIRSGVRVRKYVIFNRASLRTVSDC---VDSITTFD----RSVTDANTQLRRFCESG 75

Query: 391 YGEKA--LACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIV 218
E A L C S + TL LQ CA +++K G+E I GF +S +
Sbjct: 76 NLENAVKLLC----VSGKWDIDPRTLCSVLQLCADSKSLKDGKEVDNFIRGNGFVIDSNL 131

Query: 217 GNAIVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDV 38
G+ + MY CG L EA +VF+ + I A WN L+ + G ++ ++M V
Sbjct: 132 GSKLSLMYTNCGDLKEASRVFDEVKIEKALFWNILMNELAKSGDFSGSIGLFKKMMSSGV 191

Query: 37 CMDEITY 17
MD T+
Sbjct: 192 EMDSYTF 198


>sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containing
protein At3g23330 OS=Arabidopsis thaliana GN=PCMP-H32
PE=3 SV=1
Length = 715

Score = 126 bits (316), Expect = 9e-29
Identities = 60/187 (32%), Positives = 106/187 (56%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H VI+ GI+ + Y+ ++L+ MY + ++E +F+ L RD IS N+++AGY +G
Sbjct: 265 HGYVIRKGIDSDVYIGSSLVDMYAKSARIEDSERVFSRLYCRDGISWNSLVAGYVQNGRY 324

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+AL ++QM + V A+ + CA L + G++ H +++ GF + +A+
Sbjct: 325 NEALRLFRQMVTAKVKPGAVAFSSVIPACAHLATLHLGKQLHGYVLRGGFGSNIFIASAL 384

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
VDMY KCG++ A K+F+ + + D W +I GH HG G EA+ E M+++ V ++
Sbjct: 385 VDMYSKCGNIKAARKIFDRMNVLDEVSWTAIIMGHALHGHGHEAVSLFEEMKRQGVKPNQ 444

Query: 25 ITYVGSL 5
+ +V L
Sbjct: 445 VAFVAVL 451



Score = 90.1 bits (222), Expect = 7e-18
Identities = 45/137 (32%), Positives = 79/137 (57%)
Frame = -1

Query: 463 LFNSLVVRDTISCNTMIAGYADHGYGEKALACWQQMQSEGVTANAITLVCGLQTCAILEN 284
+F + +D +S NT+IAGYA G E AL ++M + + ++ TL L + +
Sbjct: 198 VFEVMPRKDVVSYNTIIAGYAQSGMYEDALRMVREMGTTDLKPDSFTLSSVLPIFSEYVD 257

Query: 283 VKKGREFHTNIVKKGFQGESIVGNAIVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFG 104
V KG+E H +++KG + +G+++VDMY K + ++ +VF L RD WN+L+ G
Sbjct: 258 VIKGKEIHGYVIRKGIDSDVYIGSSLVDMYAKSARIEDSERVFSRLYCRDGISWNSLVAG 317

Query: 103 HVEHGLGGEAMKYLERM 53
+V++G EA++ +M
Sbjct: 318 YVQNGRYNEALRLFRQM 334



Score = 74.7 bits (182), Expect = 3e-13
Identities = 41/154 (26%), Positives = 81/154 (52%), Gaps = 2/154 (1%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H V++ G N ++++AL+ MY++C A +F+ + V D +S +I G+A HG+G
Sbjct: 366 HGYVLRGGFGSNIFIASALVDMYSKCGNIKAARKIFDRMNVLDEVSWTAIIMGHALHGHG 425

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVK-KGFQGESIVGNA 209
+A++ +++M+ +GV N + V L C+ + V + + ++ K G E A
Sbjct: 426 HEAVSLFEEMKRQGVKPNQVAFVAVLTACSHVGLVDEAWGYFNSMTKVYGLNQELEHYAA 485

Query: 208 IVDMYVKCGSLTEACKVFESLLIR-DAALWNTLI 110
+ D+ + G L EA + + ++W+TL+
Sbjct: 486 VADLLGRAGKLEEAYNFISKMCVEPTGSVWSTLL 519



Score = 60.8 bits (146), Expect = 4e-09
Identities = 45/203 (22%), Positives = 88/203 (43%), Gaps = 36/203 (17%)
Frame = -1

Query: 520 SNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGEKALACWQQMQSEGV 341
++ +I +YT ++ EA LF +L ++ ++I + D KALA + +M++ G
Sbjct: 42 ASIVISIYTNLKLLHEALLLFKTLKSPPVLAWKSVIRCFTDQSLFSKALASFVEMRASGR 101

Query: 340 TANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVKCGSL----- 176
+ L++C ++ +++ G H IV+ G + GNA+++MY K +
Sbjct: 102 CPDHNVFPSVLKSCTMMMDLRFGESVHGFIVRLGMDCDLYTGNALMNMYAKLLGMGSKIS 161

Query: 175 ---------------------TEAC----------KVFESLLIRDAALWNTLIFGHVEHG 89
E C +VFE + +D +NT+I G+ + G
Sbjct: 162 VGNVFDEMPQRTSNSGDEDVKAETCIMPFGIDSVRRVFEVMPRKDVVSYNTIIAGYAQSG 221

Query: 88 LGGEAMKYLERMQQEDVCMDEIT 20
+ +A++ + M D+ D T
Sbjct: 222 MYEDALRMVREMGTTDLKPDSFT 244


>sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protein
At3g09040, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E88 PE=2 SV=1
Length = 1028

Score = 125 bits (315), Expect = 1e-28
Identities = 65/188 (34%), Positives = 100/188 (53%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H + IK G+ N YV ++L+ MY++C A +F +L ++ + N MI GYA +G
Sbjct: 350 HAEAIKLGLASNIYVGSSLVSMYSKCEKMEAAAKVFEALEEKNDVFWNAMIRGYAHNGES 409

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
K + + M+S G + T L TCA +++ G +FH+ I+KK VGNA+
Sbjct: 410 HKVMELFMDMKSSGYNIDDFTFTSLLSTCAASHDLEMGSQFHSIIIKKKLAKNLFVGNAL 469

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
VDMY KCG+L +A ++FE + RD WNT+I +V+ EA +RM + D
Sbjct: 470 VDMYAKCGALEDARQIFERMCDRDNVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSDG 529

Query: 25 ITYVGSLK 2
+LK
Sbjct: 530 ACLASTLK 537



Score = 112 bits (280), Expect = 1e-24
Identities = 60/190 (31%), Positives = 109/190 (57%), Gaps = 2/190 (1%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +K G++R+ + ++LI MY++C + +A +F+SL +S N +IAGY+ +
Sbjct: 552 HCLSVKCGLDRDLHTGSSLIDMYSKCGIIKDARKVFSSLPEWSVVSMNALIAGYSQNNL- 610

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGE-SIVGNA 209
E+A+ +Q+M + GV + IT ++ C E++ G +FH I K+GF E +G +
Sbjct: 611 EEAVVLFQEMLTRGVNPSEITFATIVEACHKPESLTLGTQFHGQITKRGFSSEGEYLGIS 670

Query: 208 IVDMYVKCGSLTEACKVFESLLI-RDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCM 32
++ MY+ +TEAC +F L + LW ++ GH ++G EA+K+ + M+ + V
Sbjct: 671 LLGMYMNSRGMTEACALFSELSSPKSIVLWTGMMSGHSQNGFYEEALKFYKEMRHDGVLP 730

Query: 31 DEITYVGSLK 2
D+ T+V L+
Sbjct: 731 DQATFVTVLR 740



Score = 109 bits (272), Expect = 1e-23
Identities = 59/190 (31%), Positives = 108/190 (56%), Gaps = 3/190 (1%)
Frame = -1

Query: 565 HDKVIKHGIE-RNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNT-MIAGYADHG 392
H ++ K G Y+ +L+ MY R EA LF+ L +I T M++G++ +G
Sbjct: 652 HGQITKRGFSSEGEYLGISLLGMYMNSRGMTEACALFSELSSPKSIVLWTGMMSGHSQNG 711

Query: 391 YGEKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGN 212
+ E+AL +++M+ +GV + T V L+ C++L ++++GR H+ I + + N
Sbjct: 712 FYEEALKFYKEMRHDGVLPDQATFVTVLRVCSVLSSLREGRAIHSLIFHLAHDLDELTSN 771

Query: 211 AIVDMYVKCGSLTEACKVFESLLIR-DAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVC 35
++DMY KCG + + +VF+ + R + WN+LI G+ ++G +A+K + M+Q +
Sbjct: 772 TLIDMYAKCGDMKGSSQVFDEMRRRSNVVSWNSLINGYAKNGYAEDALKIFDSMRQSHIM 831

Query: 34 MDEITYVGSL 5
DEIT++G L
Sbjct: 832 PDEITFLGVL 841



Score = 105 bits (262), Expect = 2e-22
Identities = 59/184 (32%), Positives = 96/184 (52%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H K + GI+ + NA++ +Y +C AE F+ L +D + N+M++ Y+ G
Sbjct: 83 HSKSLILGIDSEGRLGNAIVDLYAKCAQVSYAEKQFDFLE-KDVTAWNSMLSMYSSIGKP 141

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
K L + + + N T L TCA NV+ GR+ H +++K G + S G A+
Sbjct: 142 GKVLRSFVSLFENQIFPNKFTFSIVLSTCARETNVEFGRQIHCSMIKMGLERNSYCGGAL 201

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
VDMY KC +++A +VFE ++ + W L G+V+ GL EA+ ERM+ E D
Sbjct: 202 VDMYAKCDRISDARRVFEWIVDPNTVCWTCLFSGYVKAGLPEEAVLVFERMRDEGHRPDH 261

Query: 25 ITYV 14
+ +V
Sbjct: 262 LAFV 265



Score = 97.8 bits (242), Expect = 3e-20
Identities = 55/183 (30%), Positives = 93/183 (50%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +IK + +N +V NAL+ MY +C +A +F + RD ++ NT+I Y
Sbjct: 451 HSIIIKKKLAKNLFVGNALVDMYAKCGALEDARQIFERMCDRDNVTWNTIIGSYVQDENE 510

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+A +++M G+ ++ L L+ C + + +G++ H VK G + G+++
Sbjct: 511 SEAFDLFKRMNLCGIVSDGACLASTLKACTHVHGLYQGKQVHCLSVKCGLDRDLHTGSSL 570

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+DMY KCG + +A KVF SL N LI G+ ++ L EA+ + M V E
Sbjct: 571 IDMYSKCGIIKDARKVFSSLPEWSVVSMNALIAGYSQNNL-EEAVVLFQEMLTRGVNPSE 629

Query: 25 ITY 17
IT+
Sbjct: 630 ITF 632



Score = 80.9 bits (198), Expect = 4e-15
Identities = 47/169 (27%), Positives = 77/169 (45%)
Frame = -1

Query: 511 LIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGEKALACWQQMQSEGVTAN 332
+I Y R +A LF + D ++ N MI+G+ G A+ + M+ V +
Sbjct: 267 VINTYIRLGKLKDARLLFGEMSSPDVVAWNVMISGHGKRGCETVAIEYFFNMRKSSVKST 326

Query: 331 AITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVKCGSLTEACKVFE 152
TL L I+ N+ G H +K G VG+++V MY KC + A KVFE
Sbjct: 327 RSTLGSVLSAIGIVANLDLGLVVHAEAIKLGLASNIYVGSSLVSMYSKCEKMEAAAKVFE 386

Query: 151 SLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEITYVGSL 5
+L ++ WN +I G+ +G + M+ M+ +D+ T+ L
Sbjct: 387 ALEEKNDVFWNAMIRGYAHNGESHKVMELFMDMKSSGYNIDDFTFTSLL 435



Score = 72.0 bits (175), Expect = 2e-12
Identities = 43/176 (24%), Positives = 76/176 (43%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +IK G+ERNSY AL+ MY +C +A +F +V +T+ + +GY G
Sbjct: 183 HCSMIKMGLERNSYCGGALVDMYAKCDRISDARRVFEWIVDPNTVCWTCLFSGYVKAGLP 242

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
E+A+ +++M+ EG + + V +
Sbjct: 243 EEAVLVFERMRDEGHRPDHLAFV-----------------------------------TV 267

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDV 38
++ Y++ G L +A +F + D WN +I GH + G A++Y M++ V
Sbjct: 268 INTYIRLGKLKDARLLFGEMSSPDVVAWNVMISGHGKRGCETVAIEYFFNMRKSSV 323



Score = 62.4 bits (150), Expect = 2e-09
Identities = 46/162 (28%), Positives = 77/162 (47%), Gaps = 3/162 (1%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVR-DTISCNTMIAGYADHGY 389
H + + + SN LI MY +C + +F+ + R + +S N++I GYA +GY
Sbjct: 755 HSLIFHLAHDLDELTSNTLIDMYAKCGDMKGSSQVFDEMRRRSNVVSWNSLINGYAKNGY 814

Query: 388 GEKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGRE-FHTNIVKKGFQGESIVGN 212
E AL + M+ + + IT + L C+ V GR+ F I + G +
Sbjct: 815 AEDALKIFDSMRQSHIMPDEITFLGVLTACSHAGKVSDGRKIFEMMIGQYGIEARVDHVA 874

Query: 211 AIVDMYVKCGSLTEACKVFESLLIR-DAALWNTLIFGHVEHG 89
+VD+ + G L EA E+ ++ DA LW++L+ HG
Sbjct: 875 CMVDLLGRWGYLQEADDFIEAQNLKPDARLWSSLLGACRIHG 916



Score = 47.0 bits (110), Expect = 7e-05
Identities = 23/86 (26%), Positives = 45/86 (52%)
Frame = -1

Query: 274 GREFHTNIVKKGFQGESIVGNAIVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVE 95
G+ H+ + G E +GNAIVD+Y KC ++ A K F+ L +D WN+++ +
Sbjct: 79 GKAVHSKSLILGIDSEGRLGNAIVDLYAKCAQVSYAEKQFD-FLEKDVTAWNSMLSMYSS 137

Query: 94 HGLGGEAMKYLERMQQEDVCMDEITY 17
G G+ ++ + + + ++ T+
Sbjct: 138 IGKPGKVLRSFVSLFENQIFPNKFTF 163


>sp|Q8LK93|PP145_ARATH Pentatricopeptide repeat-containing protein
At2g02980 OS=Arabidopsis thaliana GN=PCMP-H26 PE=2 SV=2
Length = 603

Score = 122 bits (307), Expect = 9e-28
Identities = 66/187 (35%), Positives = 102/187 (54%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +K G++ N YV LI MYT C A +F+ +V + N MI GYA
Sbjct: 152 HCLSMKLGLDDNVYVCPTLINMYTECEDVDSARCVFDRIVEPCVVCYNAMITGYARRNRP 211

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+AL+ +++MQ + + N ITL+ L +CA+L ++ G+ H K F V A+
Sbjct: 212 NEALSLFREMQGKYLKPNEITLLSVLSSCALLGSLDLGKWIHKYAKKHSFCKYVKVNTAL 271

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+DM+ KCGSL +A +FE + +D W+ +I + HG ++M ERM+ E+V DE
Sbjct: 272 IDMFAKCGSLDDAVSIFEKMRYKDTQAWSAMIVAYANHGKAEKSMLMFERMRSENVQPDE 331

Query: 25 ITYVGSL 5
IT++G L
Sbjct: 332 ITFLGLL 338



Score = 76.6 bits (187), Expect = 8e-14
Identities = 51/177 (28%), Positives = 89/177 (50%), Gaps = 2/177 (1%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H KH + V+ ALI M+ +C +A ++F + +DT + + MI YA+HG
Sbjct: 253 HKYAKKHSFCKYVKVNTALIDMFAKCGSLDDAVSIFEKMRYKDTQAWSAMIVAYANHGKA 312

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKK-GFQGESIVGNA 209
EK++ +++M+SE V + IT + L C+ V++GR++ + +V K G +
Sbjct: 313 EKSMLMFERMRSENVQPDEITFLGLLNACSHTGRVEEGRKYFSQMVSKFGIVPSIKHYGS 372

Query: 208 IVDMYVKCGSLTEACKVFESLLIRDA-ALWNTLIFGHVEHGLGGEAMKYLERMQQED 41
+VD+ + G+L +A + + L I LW L+ H A K ER+ + D
Sbjct: 373 MVDLLSRAGNLEDAYEFIDKLPISPTPMLWRILLAACSSHNNLDLAEKVSERIFELD 429



Score = 62.4 bits (150), Expect = 2e-09
Identities = 36/156 (23%), Positives = 74/156 (47%)
Frame = -1

Query: 472 AENLFNSLVVRDTISCNTMIAGYADHGYGEKALACWQQMQSEGVTANAITLVCGLQTCAI 293
A +LF ++ D + N+M GY+ + + + ++ +G+ + T L+ CA+
Sbjct: 82 ARHLFEAMSEPDIVIFNSMARGYSRFTNPLEVFSLFVEILEDGILPDNYTFPSLLKACAV 141

Query: 292 LENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVKCGSLTEACKVFESLLIRDAALWNTL 113
+ +++GR+ H +K G V +++MY +C + A VF+ ++ +N +
Sbjct: 142 AKALEEGRQLHCLSMKLGLDDNVYVCPTLINMYTECEDVDSARCVFDRIVEPCVVCYNAM 201

Query: 112 IFGHVEHGLGGEAMKYLERMQQEDVCMDEITYVGSL 5
I G+ EA+ MQ + + +EIT + L
Sbjct: 202 ITGYARRNRPNEALSLFREMQGKYLKPNEITLLSVL 237


>sp|Q9LVF9|PP245_ARATH Pentatricopeptide repeat-containing protein
At3g21470 OS=Arabidopsis thaliana GN=PCMP-E29 PE=2 SV=1
Length = 523

Score = 122 bits (305), Expect = 2e-27
Identities = 66/178 (37%), Positives = 99/178 (55%)
Frame = -1

Query: 538 ERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGEKALACWQQ 359
E+N++V + ++ Y R EA +F + RD + NT+IAGYA +GY + A+ +
Sbjct: 205 EKNAFVWSLMMSGYFRIGDVHEARAIFYRVFARDLVIWNTLIAGYAQNGYSDDAIDAFFN 264

Query: 358 MQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVKCGS 179
MQ EG +A+T+ L CA + GRE H+ I +G + V NA++DMY KCG
Sbjct: 265 MQGEGYEPDAVTVSSILSACAQSGRLDVGREVHSLINHRGIELNQFVSNALIDMYAKCGD 324

Query: 178 LTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEITYVGSL 5
L A VFES+ +R A N++I HG G EA++ M+ D+ DEIT++ L
Sbjct: 325 LENATSVFESISVRSVACCNSMISCLAIHGKGKEALEMFSTMESLDLKPDEITFIAVL 382



Score = 73.6 bits (179), Expect = 7e-13
Identities = 51/181 (28%), Positives = 86/181 (47%), Gaps = 12/181 (6%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H + GIE N +VSNALI MY +C A ++F S+ VR CN+MI+ A HG G
Sbjct: 297 HSLINHRGIELNQFVSNALIDMYAKCGDLENATSVFESISVRSVACCNSMISCLAIHGKG 356

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCA----ILENVKKGREFHTNIVKKGFQGESIV 218
++AL + M+S + + IT + L C ++E +K E T VK +
Sbjct: 357 KEALEMFSTMESLDLKPDEITFIAVLTACVHGGFLMEGLKIFSEMKTQDVKPNVKH---- 412

Query: 217 GNAIVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFG--------HVEHGLGGEAMKYL 62
++ + + G L EA ++ + + ++ N + G H++ + + MK +
Sbjct: 413 FGCLIHLLGRSGKLKEAYRLVKEMHVKP----NDTVLGALLGACKVHMDTEMAEQVMKII 468

Query: 61 E 59
E
Sbjct: 469 E 469



Score = 61.6 bits (148), Expect = 3e-09
Identities = 38/143 (26%), Positives = 76/143 (53%), Gaps = 2/143 (1%)
Frame = -1

Query: 424 NTMIAGYADHGYGEKALACWQQMQSEGVTANA-ITLVCGLQTCA-ILENVKKGREFHTNI 251
+ +I + G +AL + ++ GV + L+ L+ CA ++ V G+ H+
Sbjct: 15 SNLIKNHISRGSPIQALVLYGGIRRRGVYFPGWVPLI--LRACACVVPRVVLGKLLHSES 72

Query: 250 VKKGFQGESIVGNAIVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAM 71
+K G + +VG++++ MY KCG + A KVF+ + R+ A WN +I G++ + G+A+
Sbjct: 73 IKFGVCSDVMVGSSLISMYGKCGCVVSARKVFDEMPERNVATWNAMIGGYMSN---GDAV 129

Query: 70 KYLERMQQEDVCMDEITYVGSLK 2
++ VC + +T++ +K
Sbjct: 130 LASGLFEEISVCRNTVTWIEMIK 152



Score = 57.4 bits (137), Expect = 5e-08
Identities = 41/177 (23%), Positives = 85/177 (48%), Gaps = 1/177 (0%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H + IK G+ + V ++LI MY +C + A +F+ + R+ + N MI GY +G
Sbjct: 69 HSESIKFGVCSDVMVGSSLISMYGKCGCVVSARKVFDEMPERNVATWNAMIGGYMSNGDA 128

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVG-NA 209
A ++++ V N +T + ++ ++K RE + F+ +++ +
Sbjct: 129 VLASGLFEEIS---VCRNTVTWIEMIKGYGKRIEIEKARELFERMP---FELKNVKAWSV 182

Query: 208 IVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDV 38
++ +YV + +A K FE + ++A +W+ ++ G+ G EA R+ D+
Sbjct: 183 MLGVYVNNRKMEDARKFFEDIPEKNAFVWSLMMSGYFRIGDVHEARAIFYRVFARDL 239


>sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protein
At4g39530 OS=Arabidopsis thaliana GN=PCMP-E52 PE=1 SV=1
Length = 834

Score = 121 bits (303), Expect = 3e-27
Identities = 60/187 (32%), Positives = 104/187 (55%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H + K+G+ + + +ALI +Y+ C ++ +F+ + V+D + N+M AGY
Sbjct: 477 HGLMFKYGLNLDIFAGSALIDVYSNCYCLKDSRLVFDEMKVKDLVIWNSMFAGYVQQSEN 536

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
E+AL + ++Q + T + L +V+ G+EFH ++K+G + + NA+
Sbjct: 537 EEALNLFLELQLSRERPDEFTFANMVTAAGNLASVQLGQEFHCQLLKRGLECNPYITNAL 596

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+DMY KCGS +A K F+S RD WN++I + HG G +A++ LE+M E + +
Sbjct: 597 LDMYAKCGSPEDAHKAFDSAASRDVVCWNSVISSYANHGEGKKALQMLEKMMSEGIEPNY 656

Query: 25 ITYVGSL 5
IT+VG L
Sbjct: 657 ITFVGVL 663



Score = 94.7 bits (234), Expect = 3e-19
Identities = 54/191 (28%), Positives = 95/191 (49%), Gaps = 3/191 (1%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++++G+E ++ + N LI Y +C I A LFN + ++ IS T+++GY +
Sbjct: 272 HAHILRYGLEMDASLMNVLIDSYVKCGRVIAAHKLFNGMPNKNIISWTTLLSGYKQNALH 331

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
++A+ + M G+ + L +CA L + G + H +K +S V N++
Sbjct: 332 KEAMELFTSMSKFGLKPDMYACSSILTSCASLHALGFGTQVHAYTIKANLGNDSYVTNSL 391

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLG---GEAMKYLERMQQEDVC 35
+DMY KC LT+A KVF+ D L+N +I G+ G EA+ M+ +
Sbjct: 392 IDMYAKCDCLTDARKVFDIFAAADVVLFNAMIEGYSRLGTQWELHEALNIFRDMRFRLIR 451

Query: 34 MDEITYVGSLK 2
+T+V L+
Sbjct: 452 PSLLTFVSLLR 462



Score = 92.8 bits (229), Expect = 1e-18
Identities = 52/160 (32%), Positives = 91/160 (56%), Gaps = 1/160 (0%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +++K G+E N Y++NAL+ MY +C +A F+S RD + N++I+ YA+HG G
Sbjct: 578 HCQLLKRGLECNPYITNALLDMYAKCGSPEDAHKAFDSAASRDVVCWNSVISSYANHGEG 637

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+KAL ++M SEG+ N IT V L C+ V+ G + +++ G + E+ +
Sbjct: 638 KKALQMLEKMMSEGIEPNYITFVGVLSACSHAGLVEDGLKQFELMLRFGIEPETEHYVCM 697

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAAL-WNTLIFGHVEHG 89
V + + G L +A ++ E + + AA+ W +L+ G + G
Sbjct: 698 VSLLGRAGRLNKARELIEKMPTKPAAIVWRSLLSGCAKAG 737



Score = 92.0 bits (227), Expect = 2e-18
Identities = 51/186 (27%), Positives = 93/186 (50%), Gaps = 3/186 (1%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H IK + +SYV+N+LI MY +C +A +F+ D + N MI GY+ G
Sbjct: 373 HAYTIKANLGNDSYVTNSLIDMYAKCDCLTDARKVFDIFAAADVVLFNAMIEGYSRLGTQ 432

Query: 385 ---EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVG 215
+AL ++ M+ + + +T V L+ A L ++ ++ H + K G + G
Sbjct: 433 WELHEALNIFRDMRFRLIRPSLLTFVSLLRASASLTSLGLSKQIHGLMFKYGLNLDIFAG 492

Query: 214 NAIVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVC 35
+A++D+Y C L ++ VF+ + ++D +WN++ G+V+ EA+ +Q
Sbjct: 493 SALIDVYSNCYCLKDSRLVFDEMKVKDLVIWNSMFAGYVQQSENEEALNLFLELQLSRER 552

Query: 34 MDEITY 17
DE T+
Sbjct: 553 PDEFTF 558



Score = 90.9 bits (224), Expect = 4e-18
Identities = 48/170 (28%), Positives = 90/170 (52%)
Frame = -1

Query: 556 VIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGEKA 377
++K G +R+ YV LI Y + A +F++L + T++ TMI+G G +
Sbjct: 174 LVKSGFDRDVYVGTLLIDFYLKDGNIDYARLVFDALPEKSTVTWTTMISGCVKMGRSYVS 233

Query: 376 LACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDM 197
L + Q+ + V + L L C+IL ++ G++ H +I++ G + ++ + N ++D
Sbjct: 234 LQLFYQLMEDNVVPDGYILSTVLSACSILPFLEGGKQIHAHILRYGLEMDASLMNVLIDS 293

Query: 196 YVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQ 47
YVKCG + A K+F + ++ W TL+ G+ ++ L EAM+ M +
Sbjct: 294 YVKCGRVIAAHKLFNGMPNKNIISWTTLLSGYKQNALHKEAMELFTSMSK 343



Score = 84.0 bits (206), Expect = 5e-16
Identities = 50/184 (27%), Positives = 99/184 (53%), Gaps = 5/184 (2%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++I G+E ++Y+SN LI +Y+R + A +F + R+ +S +TM++ HG
Sbjct: 67 HGQIIVWGLELDTYLSNILINLYSRAGGMVYARKVFEKMPERNLVSWSTMVSACNHHGIY 126

Query: 385 EKALACWQQM-QSEGVTANAITLVCGLQTCAILENVKKGR----EFHTNIVKKGFQGESI 221
E++L + + ++ + N L +Q C+ L+ +GR + + +VK GF +
Sbjct: 127 EESLVVFLEFWRTRKDSPNEYILSSFIQACSGLDG--RGRWMVFQLQSFLVKSGFDRDVY 184

Query: 220 VGNAIVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQED 41
VG ++D Y+K G++ A VF++L + W T+I G V+ G +++ ++ +++
Sbjct: 185 VGTLLIDFYLKDGNIDYARLVFDALPEKSTVTWTTMISGCVKMGRSYVSLQLFYQLMEDN 244

Query: 40 VCMD 29
V D
Sbjct: 245 VVPD 248


>sp|Q0WN60|PPR48_ARATH Pentatricopeptide repeat-containing protein
At1g18485 OS=Arabidopsis thaliana GN=PCMP-H8 PE=2 SV=2
Length = 970

Score = 120 bits (302), Expect = 4e-27
Identities = 58/187 (31%), Positives = 110/187 (58%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +I++ +ER+ +V +++ +Y C + LF+++ + +S NT+I GY +G+
Sbjct: 519 HGFIIRNWLERDLFVYLSVLSLYIHCGELCTVQALFDAMEDKSLVSWNTVITGYLQNGFP 578

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
++AL ++QM G+ I+++ C++L +++ GRE H +K + ++ + ++
Sbjct: 579 DRALGVFRQMVLYGIQLCGISMMPVFGACSLLPSLRLGREAHAYALKHLLEDDAFIACSL 638

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+DMY K GS+T++ KVF L + A WN +I G+ HGL EA+K E MQ+ D+
Sbjct: 639 IDMYAKNGSITQSSKVFNGLKEKSTASWNAMIMGYGIHGLAKEAIKLFEEMQRTGHNPDD 698

Query: 25 ITYVGSL 5
+T++G L
Sbjct: 699 LTFLGVL 705



Score = 90.1 bits (222), Expect = 7e-18
Identities = 57/193 (29%), Positives = 94/193 (48%), Gaps = 6/193 (3%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H V+K G+ + +V NAL+ Y +A LF+ + R+ +S N+MI ++D+G+
Sbjct: 210 HGLVVKTGLVEDVFVGNALVSFYGTHGFVTDALQLFDIMPERNLVSWNSMIRVFSDNGFS 269

Query: 385 EKALACWQQMQSEG----VTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIV 218
E++ +M E + TLV L CA + G+ H VK E ++
Sbjct: 270 EESFLLLGEMMEENGDGAFMPDVATLVTVLPVCAREREIGLGKGVHGWAVKLRLDKELVL 329

Query: 217 GNAIVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQ--E 44
NA++DMY KCG +T A +F+ ++ WNT++ G G L +M E
Sbjct: 330 NNALMDMYSKCGCITNAQMIFKMNNNKNVVSWNTMVGGFSAEGDTHGTFDVLRQMLAGGE 389

Query: 43 DVCMDEITYVGSL 5
DV DE+T + ++
Sbjct: 390 DVKADEVTILNAV 402



Score = 80.9 bits (198), Expect = 4e-15
Identities = 46/159 (28%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +K +++ ++NAL+ MY++C A+ +F ++ +S NTM+ G++ G
Sbjct: 315 HGWAVKLRLDKELVLNNALMDMYSKCGCITNAQMIFKMNNNKNVVSWNTMVGGFSAEGDT 374

Query: 385 EKALACWQQMQSEG--VTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGN 212
+QM + G V A+ +T++ + C + +E H +K+ F +V N
Sbjct: 375 HGTFDVLRQMLAGGEDVKADEVTILNAVPVCFHESFLPSLKELHCYSLKQEFVYNELVAN 434

Query: 211 AIVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVE 95
A V Y KCGSL+ A +VF + + WN LI GH +
Sbjct: 435 AFVASYAKCGSLSYAQRVFHGIRSKTVNSWNALIGGHAQ 473



Score = 80.1 bits (196), Expect = 7e-15
Identities = 41/171 (23%), Positives = 85/171 (49%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +K N V+NA + Y +C A+ +F+ + + S N +I G+A
Sbjct: 418 HCYSLKQEFVYNELVANAFVASYAKCGSLSYAQRVFHGIRSKTVNSWNALIGGHAQSNDP 477

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+L QM+ G+ ++ T+ L C+ L++++ G+E H I++ + + V ++
Sbjct: 478 RLSLDAHLQMKISGLLPDSFTVCSLLSACSKLKSLRLGKEVHGFIIRNWLERDLFVYLSV 537

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERM 53
+ +Y+ CG L +F+++ + WNT+I G++++G A+ +M
Sbjct: 538 LSLYIHCGELCTVQALFDAMEDKSLVSWNTVITGYLQNGFPDRALGVFRQM 588



Score = 65.9 bits (159), Expect = 1e-10
Identities = 41/168 (24%), Positives = 83/168 (49%), Gaps = 1/168 (0%)
Frame = -1

Query: 541 IERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGEKALACWQ 362
+ + + +I MY C ++ +F++L ++ N +I+ Y+ + ++ L +
Sbjct: 116 LRNDDVLCTRIITMYAMCGSPDDSRFVFDALRSKNLFQWNAVISSYSRNELYDEVLETFI 175

Query: 361 QMQSE-GVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVKC 185
+M S + + T C ++ CA + +V G H +VK G + VGNA+V Y
Sbjct: 176 EMISTTDLLPDHFTYPCVIKACAGMSDVGIGLAVHGLVVKTGLVEDVFVGNALVSFYGTH 235

Query: 184 GSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQED 41
G +T+A ++F+ + R+ WN++I ++G E+ L M +E+
Sbjct: 236 GFVTDALQLFDIMPERNLVSWNSMIRVFSDNGFSEESFLLLGEMMEEN 283



Score = 62.0 bits (149), Expect = 2e-09
Identities = 38/155 (24%), Positives = 74/155 (47%), Gaps = 3/155 (1%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +KH +E +++++ +LI MY + ++ +FN L + T S N MI GY HG
Sbjct: 620 HAYALKHLLEDDAFIACSLIDMYAKNGSITQSSKVFNGLKEKSTASWNAMIMGYGIHGLA 679

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKK-GFQGESIVGNA 209
++A+ +++MQ G + +T + L C + +G + + G +
Sbjct: 680 KEAIKLFEEMQRTGHNPDDLTFLGVLTACNHSGLIHEGLRYLDQMKSSFGLKPNLKHYAC 739

Query: 208 IVDMYVKCGSLTEACKVFESLLIR--DAALWNTLI 110
++DM + G L +A +V + D +W +L+
Sbjct: 740 VIDMLGRAGQLDKALRVVAEEMSEEADVGIWKSLL 774


>sp|Q9LYV3|PP377_ARATH Putative pentatricopeptide repeat-containing
protein At5g13230, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H89 PE=3 SV=1
Length = 822

Score = 120 bits (302), Expect = 4e-27
Identities = 65/187 (34%), Positives = 101/187 (54%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H V+K G + + YVSNALI +Y +C A LF L ++ +S NT+I GY + G G
Sbjct: 371 HGLVVKVGFDLDIYVSNALIDVYAKCEKMDTAVKLFAELSSKNEVSWNTVIVGYENLGEG 430

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
KA + +++ V+ +T L CA L ++ G + H +K + V N++
Sbjct: 431 GKAFSMFREALRNQVSVTEVTFSSALGACASLASMDLGVQVHGLAIKTNNAKKVAVSNSL 490

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+DMY KCG + A VF + D A WN LI G+ HGLG +A++ L+ M+ D +
Sbjct: 491 IDMYAKCGDIKFAQSVFNEMETIDVASWNALISGYSTHGLGRQALRILDIMKDRDCKPNG 550

Query: 25 ITYVGSL 5
+T++G L
Sbjct: 551 LTFLGVL 557



Score = 95.1 bits (235), Expect = 2e-19
Identities = 54/187 (28%), Positives = 93/187 (49%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +++K + V L+ +YT+ +A +FN + D + + MIA + +G+
Sbjct: 270 HGQILKTCYVLDPRVGVGLLQLYTQLGDMSDAFKVFNEMPKNDVVPWSFMIARFCQNGFC 329

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+A+ + +M+ V N TL L CAI + G + H +VK GF + V NA+
Sbjct: 330 NEAVDLFIRMREAFVVPNEFTLSSILNGCAIGKCSGLGEQLHGLVVKVGFDLDIYVSNAL 389

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+D+Y KC + A K+F L ++ WNT+I G+ G GG+A + V + E
Sbjct: 390 IDVYAKCEKMDTAVKLFAELSSKNEVSWNTVIVGYENLGEGGKAFSMFREALRNQVSVTE 449

Query: 25 ITYVGSL 5
+T+ +L
Sbjct: 450 VTFSSAL 456



Score = 79.7 bits (195), Expect = 9e-15
Identities = 49/188 (26%), Positives = 91/188 (48%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++K G + + +N L+ Y + +A NLF+ + R+ +S T+ GYA
Sbjct: 72 HCDILKKGSCLDLFATNILLNAYVKAGFDKDALNLFDEMPERNNVSFVTLAQGYAC---- 127

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+ + + ++ EG N L+ L+ + H+ IVK G+ + VG A+
Sbjct: 128 QDPIGLYSRLHREGHELNPHVFTSFLKLFVSLDKAEICPWLHSPIVKLGYDSNAFVGAAL 187

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
++ Y CGS+ A VFE +L +D +W ++ +VE+G +++K L M+ +
Sbjct: 188 INAYSVCGSVDSARTVFEGILCKDIVVWAGIVSCYVENGYFEDSLKLLSCMRMAGFMPNN 247

Query: 25 ITYVGSLK 2
T+ +LK
Sbjct: 248 YTFDTALK 255



Score = 76.6 bits (187), Expect = 8e-14
Identities = 46/182 (25%), Positives = 85/182 (46%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++K G + N++V ALI Y+ C A +F ++ +D + +++ Y ++GY
Sbjct: 169 HSPIVKLGYDSNAFVGAALINAYSVCGSVDSARTVFEGILCKDIVVWAGIVSCYVENGYF 228

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
E +L M+ G N T L+ L + H I+K + + VG +
Sbjct: 229 EDSLKLLSCMRMAGFMPNNYTFDTALKASIGLGAFDFAKGVHGQILKTCYVLDPRVGVGL 288

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+ +Y + G +++A KVF + D W+ +I ++G EA+ RM++ V +E
Sbjct: 289 LQLYTQLGDMSDAFKVFNEMPKNDVVPWSFMIARFCQNGFCNEAVDLFIRMREAFVVPNE 348

Query: 25 IT 20
T
Sbjct: 349 FT 350



Score = 63.5 bits (153), Expect = 7e-10
Identities = 49/186 (26%), Positives = 84/186 (45%), Gaps = 2/186 (1%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H IK + VSN+LI MY +C A+++FN + D S N +I+GY+ HG G
Sbjct: 472 HGLAIKTNNAKKVAVSNSLIDMYAKCGDIKFAQSVFNEMETIDVASWNALISGYSTHGLG 531

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGRE-FHTNIVKKGFQGESIVGNA 209
+AL M+ N +T + L C+ + +G+E F + I G +
Sbjct: 532 RQALRILDIMKDRDCKPNGLTFLGVLSGCSNAGLIDQGQECFESMIRDHGIEPCLEHYTC 591

Query: 208 IVDMYVKCGSLTEACKVFESLLIRDAA-LWNTLIFGHVEHGLGGEAMKYLERMQQEDVCM 32
+V + + G L +A K+ E + + +W ++ + A + E + + +
Sbjct: 592 MVRLLGRSGQLDKAMKLIEGIPYEPSVMIWRAMLSASMNQNNEEFARRSAEEILKINP-K 650

Query: 31 DEITYV 14
DE TYV
Sbjct: 651 DEATYV 656



Score = 34.3 bits (77), Expect = 0.44
Identities = 28/113 (24%), Positives = 49/113 (43%)
Frame = -1

Query: 439 DTISCNTMIAGYADHGYGEKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFH 260
D S +++I G H YG C Q+ ++ ++A AI H
Sbjct: 36 DLESSDSIIPGLDSHAYGAMLRRCIQK--NDPISAKAI---------------------H 72

Query: 259 TNIVKKGFQGESIVGNAIVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGH 101
+I+KKG + N +++ YVK G +A +F+ + R+ + TL G+
Sbjct: 73 CDILKKGSCLDLFATNILLNAYVKAGFDKDALNLFDEMPERNNVSFVTLAQGY 125


>sp|Q9LFL5|PP390_ARATH Putative pentatricopeptide repeat-containing
protein At5g16860 OS=Arabidopsis thaliana GN=PCMP-H92
PE=3 SV=1
Length = 850

Score = 119 bits (299), Expect = 8e-27
Identities = 64/181 (35%), Positives = 101/181 (55%), Gaps = 1/181 (0%)
Frame = -1

Query: 544 GIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGEKALACW 365
G N +V NAL+ MY+RCR +A +F+ + V D +S N++I YA G + AL +
Sbjct: 157 GFISNVFVGNALVAMYSRCRSLSDARKVFDEMSVWDVVSWNSIIESYAKLGKPKVALEMF 216

Query: 364 QQMQSE-GVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVK 188
+M +E G + ITLV L CA L G++ H V VGN +VDMY K
Sbjct: 217 SRMTNEFGCRPDNITLVNVLPPCASLGTHSLGKQLHCFAVTSEMIQNMFVGNCLVDMYAK 276

Query: 187 CGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEITYVGS 8
CG + EA VF ++ ++D WN ++ G+ + G +A++ E+MQ+E + MD +T+ +
Sbjct: 277 CGMMDEANTVFSNMSVKDVVSWNAMVAGYSQIGRFEDAVRLFEKMQEEKIKMDVVTWSAA 336

Query: 7 L 5
+
Sbjct: 337 I 337



Score = 105 bits (261), Expect = 2e-22
Identities = 59/182 (32%), Positives = 97/182 (53%), Gaps = 5/182 (2%)
Frame = -1

Query: 550 KHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVV--RDTISCNTMIAGYADHGYGEKA 377
K+G + V N LI MY +C+ A +F+SL RD ++ MI GY+ HG KA
Sbjct: 400 KNGHGDENMVINQLIDMYAKCKKVDTARAMFDSLSPKERDVVTWTVMIGGYSQHGDANKA 459

Query: 376 LACWQQMQSEGVTA--NAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESI-VGNAI 206
L +M E NA T+ C L CA L ++ G++ H ++ + V N +
Sbjct: 460 LELLSEMFEEDCQTRPNAFTISCALVACASLAALRIGKQIHAYALRNQQNAVPLFVSNCL 519

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+DMY KCGS+++A VF++++ ++ W +L+ G+ HG G EA+ + M++ +D
Sbjct: 520 IDMYAKCGSISDARLVFDNMMAKNEVTWTSLMTGYGMHGYGEEALGIFDEMRRIGFKLDG 579

Query: 25 IT 20
+T
Sbjct: 580 VT 581



Score = 101 bits (252), Expect = 2e-21
Identities = 63/209 (30%), Positives = 98/209 (46%), Gaps = 44/209 (21%)
Frame = -1

Query: 535 RNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGY---------------- 404
+N +V N L+ MY +C M EA +F+++ V+D +S N M+AGY
Sbjct: 262 QNMFVGNCLVDMYAKCGMMDEANTVFSNMSVKDVVSWNAMVAGYSQIGRFEDAVRLFEKM 321

Query: 403 -------------------ADHGYGEKALACWQQMQSEGVTANAITLVCGLQTCAILENV 281
A G G +AL +QM S G+ N +TL+ L CA + +
Sbjct: 322 QEEKIKMDVVTWSAAISGYAQRGLGYEALGVCRQMLSSGIKPNEVTLISVLSGCASVGAL 381

Query: 280 KKGREFH-------TNIVKKGFQGESIVGNAIVDMYVKCGSLTEACKVFESL--LIRDAA 128
G+E H ++ K G E++V N ++DMY KC + A +F+SL RD
Sbjct: 382 MHGKEIHCYAIKYPIDLRKNGHGDENMVINQLIDMYAKCKKVDTARAMFDSLSPKERDVV 441

Query: 127 LWNTLIFGHVEHGLGGEAMKYLERMQQED 41
W +I G+ +HG +A++ L M +ED
Sbjct: 442 TWTVMIGGYSQHGDANKALELLSEMFEED 470



Score = 78.2 bits (191), Expect = 3e-14
Identities = 57/190 (30%), Positives = 85/190 (44%), Gaps = 3/190 (1%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDT--ISCNTMIAGYADHG 392
H K++ GI + S+ LI Y A +L D N++I Y D+G
Sbjct: 48 HQKLLSFGILTLNLTSH-LISTYISVGCLSHAVSLLRRFPPSDAGVYHWNSLIRSYGDNG 106

Query: 391 YGEKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGN 212
K L + M S T + T + C + +V+ G H + GF VGN
Sbjct: 107 CANKCLYLFGLMHSLSWTPDNYTFPFVFKACGEISSVRCGESAHALSLVTGFISNVFVGN 166

Query: 211 AIVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCM 32
A+V MY +C SL++A KVF+ + + D WN++I + + G A++ RM E C
Sbjct: 167 ALVAMYSRCRSLSDARKVFDEMSVWDVVSWNSIIESYAKLGKPKVALEMFSRMTNEFGCR 226

Query: 31 -DEITYVGSL 5
D IT V L
Sbjct: 227 PDNITLVNVL 236



Score = 65.1 bits (157), Expect = 2e-10
Identities = 35/132 (26%), Positives = 70/132 (53%), Gaps = 5/132 (3%)
Frame = -1

Query: 526 YVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGEKALACWQQMQSE 347
+VSN LI MY +C +A +F++++ ++ ++ +++ GY HGYGE+AL + +M+
Sbjct: 514 FVSNCLIDMYAKCGSISDARLVFDNMMAKNEVTWTSLMTGYGMHGYGEEALGIFDEMRRI 573

Query: 346 GVTANAITLVCGLQTCAILENVKKGREFHTNI-----VKKGFQGESIVGNAIVDMYVKCG 182
G + +TL+ L C+ + +G E+ + V G + + +VD+ + G
Sbjct: 574 GFKLDGVTLLVVLYACSHSGMIDQGMEYFNRMKTVFGVSPGPEHYA----CLVDLLGRAG 629

Query: 181 SLTEACKVFESL 146
L A ++ E +
Sbjct: 630 RLNAALRLIEEM 641


tr_hit_id A7PEB0
Definition tr|A7PEB0|A7PEB0_VITVI Chromosome chr11 scaffold_13, whole genome shotgun sequence OS=Vitis vinifera
Align length 187
Score (bit) 166.0
E-value 8.0e-40
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918660|Adiantum capillus-veneris mRNA, clone:
YMU001_000116_A11.
(565 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PEB0|A7PEB0_VITVI Chromosome chr11 scaffold_13, whole genom... 166 8e-40
tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1 145 2e-33
tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella paten... 145 2e-33
tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella paten... 144 3e-33
tr|B8LKN6|B8LKN6_PICSI Putative uncharacterized protein OS=Picea... 142 1e-32
tr|A9RSU9|A9RSU9_PHYPA Predicted protein OS=Physcomitrella paten... 137 3e-31
tr|A9TDA2|A9TDA2_PHYPA Predicted protein OS=Physcomitrella paten... 134 3e-30
tr|A9SQ58|A9SQ58_PHYPA Predicted protein OS=Physcomitrella paten... 134 3e-30
tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 ... 134 3e-30
tr|A9T5P5|A9T5P5_PHYPA Predicted protein OS=Physcomitrella paten... 133 6e-30
tr|A7QUQ9|A7QUQ9_VITVI Chromosome chr1 scaffold_180, whole genom... 133 8e-30
tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea... 132 1e-29
tr|A7QIL2|A7QIL2_VITVI Chromosome chr9 scaffold_104, whole genom... 132 1e-29
tr|A7PIZ1|A7PIZ1_VITVI Chromosome chr13 scaffold_17, whole genom... 132 1e-29
tr|A5ADX7|A5ADX7_VITVI Putative uncharacterized protein OS=Vitis... 132 1e-29
tr|A7NVQ9|A7NVQ9_VITVI Chromosome chr18 scaffold_1, whole genome... 132 2e-29
tr|A5AJZ0|A5AJZ0_VITVI Putative uncharacterized protein OS=Vitis... 132 2e-29
tr|Q8S693|Q8S693_ORYSJ Putative uncharacterized protein OJ1004_D... 130 4e-29
tr|Q10IY6|Q10IY6_ORYSJ Os03g0441400 protein OS=Oryza sativa subs... 130 4e-29
tr|A7PAH3|A7PAH3_VITVI Chromosome chr14 scaffold_9, whole genome... 130 4e-29
tr|A2XIE6|A2XIE6_ORYSI Putative uncharacterized protein OS=Oryza... 130 4e-29
tr|Q94LP5|Q94LP5_ORYSJ Os10g0558600 protein OS=Oryza sativa subs... 130 5e-29
tr|Q8SB86|Q8SB86_ORYSA Putative pentatricopeptide repeat domain ... 130 5e-29
tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella paten... 130 5e-29
tr|A5B3U0|A5B3U0_VITVI Putative uncharacterized protein OS=Vitis... 130 5e-29
tr|A3C789|A3C789_ORYSJ Putative uncharacterized protein OS=Oryza... 130 5e-29
tr|Q2HU53|Q2HU53_MEDTR Tetratricopeptide-like helical OS=Medicag... 130 7e-29
tr|A7NSK1|A7NSK1_VITVI Chromosome chr18 scaffold_1, whole genome... 129 1e-28
tr|A9T480|A9T480_PHYPA Predicted protein (Fragment) OS=Physcomit... 128 2e-28
tr|A7PRN9|A7PRN9_VITVI Chromosome chr14 scaffold_27, whole genom... 128 2e-28

>tr|A7PEB0|A7PEB0_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016595001
PE=4 SV=1
Length = 1005

Score = 166 bits (420), Expect = 8e-40
Identities = 77/187 (41%), Positives = 115/187 (61%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +++K+ ++ N +V AL+ MY + R +AE +FN L+ RD + ++AGYA G G
Sbjct: 555 HAQIVKNSLDGNDFVGTALVDMYAKNRFLEDAETIFNRLIKRDLFAWTVIVAGYAQDGQG 614

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
EKA+ C+ QMQ EGV N TL L C+ + + GR+ H+ +K G G+ V +A+
Sbjct: 615 EKAVKCFIQMQREGVKPNEFTLASSLSGCSRIATLDSGRQLHSMAIKAGQSGDMFVASAL 674

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
VDMY KCG + +A VF+ L+ RD WNT+I G+ +HG GG+A+K E M E DE
Sbjct: 675 VDMYAKCGCVEDAEVVFDGLVSRDTVSWNTIICGYSQHGQGGKALKAFEAMLDEGTVPDE 734

Query: 25 ITYVGSL 5
+T++G L
Sbjct: 735 VTFIGVL 741



Score = 117 bits (294), Expect = 3e-25
Identities = 64/187 (34%), Positives = 100/187 (53%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H V K+G E ++ V NAL+ MY + + +F + RD IS N +++G+ D+
Sbjct: 454 HACVCKYGFEYDNTVCNALVTMYMKIGSVQDGCRVFEATTNRDLISWNALLSGFHDNETC 513

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+ L + QM +EG N T + L++C+ L +V G++ H IVK G VG A+
Sbjct: 514 DTGLRIFNQMLAEGFNPNMYTFISILRSCSSLSDVDLGKQVHAQIVKNSLDGNDFVGTAL 573

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
VDMY K L +A +F L+ RD W ++ G+ + G G +A+K +MQ+E V +E
Sbjct: 574 VDMYAKNRFLEDAETIFNRLIKRDLFAWTVIVAGYAQDGQGEKAVKCFIQMQREGVKPNE 633

Query: 25 ITYVGSL 5
T SL
Sbjct: 634 FTLASSL 640



Score = 110 bits (275), Expect = 5e-23
Identities = 58/188 (30%), Positives = 100/188 (53%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +VIK GI +S++ N+L+ +Y +C A +F + RD +S +I G+ GYG
Sbjct: 151 HGQVIKSGINPDSHLWNSLVNVYAKCGSANYACKVFGEIPERDVVSWTALITGFVAEGYG 210

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
A+ + +M+ EGV AN T L+ C++ +++ G++ H +K G + VG+A+
Sbjct: 211 SGAVNLFCEMRREGVEANEFTYATALKACSMCLDLEFGKQVHAEAIKVGDFSDLFVGSAL 270

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
VD+Y KCG + A +VF + ++A WN L+ G + G + + RM ++ +
Sbjct: 271 VDLYAKCGEMVLAERVFLCMPKQNAVSWNALLNGFAQMGDAEKVLNLFCRMTGSEINFSK 330

Query: 25 ITYVGSLK 2
T LK
Sbjct: 331 FTLSTVLK 338



Score = 91.7 bits (226), Expect = 3e-17
Identities = 51/188 (27%), Positives = 93/188 (49%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H I+ G E + ++S L+ MY++C + +A +F + D +S + +I G
Sbjct: 353 HSLAIRIGCELDEFISCCLVDMYSKCGLAGDALKVFVRIEDPDVVSWSAIITCLDQKGQS 412

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+A +++M+ GV N TL + L ++ G H + K GF+ ++ V NA+
Sbjct: 413 REAAEVFKRMRHSGVIPNQFTLASLVSAATDLGDLYYGESIHACVCKYGFEYDNTVCNAL 472

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
V MY+K GS+ + C+VFE+ RD WN L+ G ++ ++ +M E +
Sbjct: 473 VTMYMKIGSVQDGCRVFEATTNRDLISWNALLSGFHDNETCDTGLRIFNQMLAEGFNPNM 532

Query: 25 ITYVGSLK 2
T++ L+
Sbjct: 533 YTFISILR 540



Score = 89.0 bits (219), Expect = 2e-16
Identities = 51/182 (28%), Positives = 92/182 (50%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H + IK G + +V +AL+ +Y +C + AE +F + ++ +S N ++ G+A G
Sbjct: 252 HAEAIKVGDFSDLFVGSALVDLYAKCGEMVLAERVFLCMPKQNAVSWNALLNGFAQMGDA 311

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
EK L + +M + + TL L+ CA N++ G+ H+ ++ G + + + +
Sbjct: 312 EKVLNLFCRMTGSEINFSKFTLSTVLKGCANSGNLRAGQIVHSLAIRIGCELDEFISCCL 371

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
VDMY KCG +A KVF + D W+ +I + G EA + +RM+ V ++
Sbjct: 372 VDMYSKCGLAGDALKVFVRIEDPDVVSWSAIITCLDQKGQSREAAEVFKRMRHSGVIPNQ 431

Query: 25 IT 20
T
Sbjct: 432 FT 433



Score = 85.9 bits (211), Expect = 1e-15
Identities = 50/162 (30%), Positives = 86/162 (53%), Gaps = 3/162 (1%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H IK G + +V++AL+ MY +C +AE +F+ LV RDT+S NT+I GY+ HG G
Sbjct: 656 HSMAIKAGQSGDMFVASALVDMYAKCGCVEDAEVVFDGLVSRDTVSWNTIICGYSQHGQG 715

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGN-- 212
KAL ++ M EG + +T + L C+ + +++G++ H N + K + + +
Sbjct: 716 GKALKAFEAMLDEGTVPDEVTFIGVLSACSHMGLIEEGKK-HFNSLSKIYGITPTIEHYA 774

Query: 211 AIVDMYVKCGSLTEACKVFESL-LIRDAALWNTLIFGHVEHG 89
+VD+ + G E E + L + +W T++ HG
Sbjct: 775 CMVDILGRAGKFHEVESFIEEMKLTSNVLIWETVLGACKMHG 816



Score = 79.3 bits (194), Expect = 1e-13
Identities = 39/103 (37%), Positives = 58/103 (56%)
Frame = -1

Query: 310 LQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVKCGSLTEACKVFESLLIRDA 131
L+TCA ++ +G+ H ++K G +S + N++V++Y KCGS ACKVF + RD
Sbjct: 135 LRTCASKGDLNEGKAIHGQVIKSGINPDSHLWNSLVNVYAKCGSANYACKVFGEIPERDV 194

Query: 130 ALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEITYVGSLK 2
W LI G V G G A+ M++E V +E TY +LK
Sbjct: 195 VSWTALITGFVAEGYGSGAVNLFCEMRREGVEANEFTYATALK 237


>tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1
Length = 986

Score = 145 bits (365), Expect = 2e-33
Identities = 72/187 (38%), Positives = 111/187 (59%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++K G+E + +VSNAL+ M+ C + A+NLFN + RD +S NT+IAG+ HG
Sbjct: 537 HFLIMKAGLESDLHVSNALVSMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGFVQHGKN 596

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+ A ++ MQ G+ + IT L CA E + +GR H I + F + +VG +
Sbjct: 597 QVAFDYFKMMQESGIKPDKITFTGLLNACASPEALTEGRRLHALITEAAFDCDVLVGTGL 656

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+ MY KCGS+ +A +VF L ++ W ++I G+ +HG G EA++ +MQQE V D
Sbjct: 657 ISMYTKCGSIEDAHQVFHKLPKKNVYSWTSMIAGYAQHGRGKEALELFYQMQQEGVKPDW 716

Query: 25 ITYVGSL 5
IT+VG+L
Sbjct: 717 ITFVGAL 723



Score = 132 bits (332), Expect = 1e-29
Identities = 64/188 (34%), Positives = 107/188 (56%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
++ + K G++ + ++ N LI MY +C I A+ +F+ + +D S N ++ GY HG
Sbjct: 133 YNHIKKSGVQPDIFMRNTLINMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLY 192

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
E+A +QM + V + T V L CA NV KGRE + I+K G+ + VG A+
Sbjct: 193 EEAFKLHEQMVQDSVKPDKRTFVSMLNACADARNVDKGRELYNLILKAGWDTDLFVGTAL 252

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
++M++KCG + +A KVF++L RD W ++I G HG +A +RM++E V D+
Sbjct: 253 INMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARHGRFKQACNLFQRMEEEGVQPDK 312

Query: 25 ITYVGSLK 2
+ +V L+
Sbjct: 313 VAFVSLLR 320



Score = 119 bits (299), Expect = 9e-26
Identities = 61/186 (32%), Positives = 97/186 (52%)
Frame = -1

Query: 562 DKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGE 383
D +I+ G + V AL+ MY +C +A +F + ++ ++ N MI Y H +
Sbjct: 437 DHIIEAGYGSDDRVRTALLSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQYD 496

Query: 382 KALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIV 203
ALA +Q + EG+ N+ T L C ++++ G+ H I+K G + + V NA+V
Sbjct: 497 NALATFQALLKEGIKPNSSTFTSILNVCKSSDSLELGKWVHFLIMKAGLESDLHVSNALV 556

Query: 202 DMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEI 23
M+V CG L A +F + RD WNT+I G V+HG A Y + MQ+ + D+I
Sbjct: 557 SMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGFVQHGKNQVAFDYFKMMQESGIKPDKI 616

Query: 22 TYVGSL 5
T+ G L
Sbjct: 617 TFTGLL 622



Score = 113 bits (282), Expect = 8e-24
Identities = 57/187 (30%), Positives = 106/187 (56%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
++ ++K G + + +V ALI M+ +C +A +F++L RD ++ +MI G A HG
Sbjct: 234 YNLILKAGWDTDLFVGTALINMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARHGRF 293

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
++A +Q+M+ EGV + + V L+ C E +++G++ H + + G+ E VG AI
Sbjct: 294 KQACNLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIYVGTAI 353

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+ MY KCGS+ +A +VF+ + R+ W +I G +HG EA + +M + + +
Sbjct: 354 LSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRIDEAFLFFNKMIESGIEPNR 413

Query: 25 ITYVGSL 5
+T++ L
Sbjct: 414 VTFMSIL 420



Score = 106 bits (265), Expect = 8e-22
Identities = 53/187 (28%), Positives = 101/187 (54%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++ + G + YV A++ MYT+C +A +F+ + R+ +S MIAG+A HG
Sbjct: 335 HARMKEVGWDTEIYVGTAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRI 394

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
++A + +M G+ N +T + L C+ +K+G++ +I++ G+ + V A+
Sbjct: 395 DEAFLFFNKMIESGIEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDDRVRTAL 454

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+ MY KCGSL +A +VFE + ++ WN +I +V+H A+ + + +E + +
Sbjct: 455 LSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQYDNALATFQALLKEGIKPNS 514

Query: 25 ITYVGSL 5
T+ L
Sbjct: 515 STFTSIL 521



Score = 84.3 bits (207), Expect = 4e-15
Identities = 44/147 (29%), Positives = 77/147 (52%)
Frame = -1

Query: 445 VRDTISCNTMIAGYADHGYGEKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGRE 266
++DT N ++ + G +A+ +++ S + T LQ C +N+ G
Sbjct: 72 IKDTQKANAVLNRLSKAGQFNEAMQVLERVDSSHIQIYRQTYSALLQLCIKFKNLGDGER 131

Query: 265 FHTNIVKKGFQGESIVGNAIVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGL 86
+ +I K G Q + + N +++MY KCG+ A ++F+ + +D WN L+ G+V+HGL
Sbjct: 132 IYNHIKKSGVQPDIFMRNTLINMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGL 191

Query: 85 GGEAMKYLERMQQEDVCMDEITYVGSL 5
EA K E+M Q+ V D+ T+V L
Sbjct: 192 YEEAFKLHEQMVQDSVKPDKRTFVSML 218



Score = 77.8 bits (190), Expect = 4e-13
Identities = 45/153 (29%), Positives = 77/153 (50%), Gaps = 1/153 (0%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H + + + + V LI MYT+C +A +F+ L ++ S +MIAGYA HG G
Sbjct: 638 HALITEAAFDCDVLVGTGLISMYTKCGSIEDAHQVFHKLPKKNVYSWTSMIAGYAQHGRG 697

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
++AL + QMQ EGV + IT V L CA +++G ++ + + +
Sbjct: 698 KEALELFYQMQQEGVKPDWITFVGALSACAHAGLIEEGLHHFQSMKEFNIEPRMEHYGCM 757

Query: 205 VDMYVKCGSLTEACKVFESLLIR-DAALWNTLI 110
VD++ + G L EA + + + D+ +W L+
Sbjct: 758 VDLFGRAGLLNEAVEFIIKMQVEPDSRVWGALL 790


>tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_224041 PE=4 SV=1
Length = 986

Score = 145 bits (365), Expect = 2e-33
Identities = 72/187 (38%), Positives = 111/187 (59%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++K G+E + +VSNAL+ M+ C + A+NLFN + RD +S NT+IAG+ HG
Sbjct: 537 HFLIMKAGLESDLHVSNALVSMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGFVQHGKN 596

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+ A ++ MQ G+ + IT L CA E + +GR H I + F + +VG +
Sbjct: 597 QVAFDYFKMMQESGIKPDKITFTGLLNACASPEALTEGRRLHALITEAAFDCDVLVGTGL 656

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+ MY KCGS+ +A +VF L ++ W ++I G+ +HG G EA++ +MQQE V D
Sbjct: 657 ISMYTKCGSIEDAHQVFHKLPKKNVYSWTSMITGYAQHGRGKEALELFYQMQQEGVKPDW 716

Query: 25 ITYVGSL 5
IT+VG+L
Sbjct: 717 ITFVGAL 723



Score = 131 bits (330), Expect = 2e-29
Identities = 64/188 (34%), Positives = 107/188 (56%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
++ + K G++ + ++ N LI MY +C I A+ +F+ + +D S N ++ GY HG
Sbjct: 133 YNHIKKSGVQPDIFMWNTLINMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLY 192

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
E+A +QM + V + T V L CA NV KGRE + I+K G+ + VG A+
Sbjct: 193 EEAFKLHEQMVQDSVKPDKRTFVSMLNACADARNVDKGRELYNLILKAGWDTDLFVGTAL 252

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
++M++KCG + +A KVF++L RD W ++I G HG +A +RM++E V D+
Sbjct: 253 INMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARHGRFKQACNLFQRMEEEGVQPDK 312

Query: 25 ITYVGSLK 2
+ +V L+
Sbjct: 313 VAFVSLLR 320



Score = 119 bits (299), Expect = 9e-26
Identities = 61/186 (32%), Positives = 97/186 (52%)
Frame = -1

Query: 562 DKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGE 383
D +I+ G + V AL+ MY +C +A +F + ++ ++ N MI Y H +
Sbjct: 437 DHIIEAGYGSDDRVRTALLSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQYD 496

Query: 382 KALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIV 203
ALA +Q + EG+ N+ T L C ++++ G+ H I+K G + + V NA+V
Sbjct: 497 NALATFQALLKEGIKPNSSTFTSILNVCKSSDSLELGKWVHFLIMKAGLESDLHVSNALV 556

Query: 202 DMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEI 23
M+V CG L A +F + RD WNT+I G V+HG A Y + MQ+ + D+I
Sbjct: 557 SMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGFVQHGKNQVAFDYFKMMQESGIKPDKI 616

Query: 22 TYVGSL 5
T+ G L
Sbjct: 617 TFTGLL 622



Score = 113 bits (282), Expect = 8e-24
Identities = 57/187 (30%), Positives = 106/187 (56%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
++ ++K G + + +V ALI M+ +C +A +F++L RD ++ +MI G A HG
Sbjct: 234 YNLILKAGWDTDLFVGTALINMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARHGRF 293

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
++A +Q+M+ EGV + + V L+ C E +++G++ H + + G+ E VG AI
Sbjct: 294 KQACNLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIYVGTAI 353

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+ MY KCGS+ +A +VF+ + R+ W +I G +HG EA + +M + + +
Sbjct: 354 LSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRIDEAFLFFNKMIESGIEPNR 413

Query: 25 ITYVGSL 5
+T++ L
Sbjct: 414 VTFMSIL 420



Score = 106 bits (265), Expect = 8e-22
Identities = 53/187 (28%), Positives = 101/187 (54%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++ + G + YV A++ MYT+C +A +F+ + R+ +S MIAG+A HG
Sbjct: 335 HARMKEVGWDTEIYVGTAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRI 394

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
++A + +M G+ N +T + L C+ +K+G++ +I++ G+ + V A+
Sbjct: 395 DEAFLFFNKMIESGIEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDDRVRTAL 454

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+ MY KCGSL +A +VFE + ++ WN +I +V+H A+ + + +E + +
Sbjct: 455 LSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQYDNALATFQALLKEGIKPNS 514

Query: 25 ITYVGSL 5
T+ L
Sbjct: 515 STFTSIL 521



Score = 84.3 bits (207), Expect = 4e-15
Identities = 44/147 (29%), Positives = 77/147 (52%)
Frame = -1

Query: 445 VRDTISCNTMIAGYADHGYGEKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGRE 266
++DT N ++ + G +A+ +++ S + T LQ C +N+ G
Sbjct: 72 IKDTQKANAVLNRLSKAGQFNEAMQVLERVDSSHIQIYRQTYSALLQLCIKFKNLGDGER 131

Query: 265 FHTNIVKKGFQGESIVGNAIVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGL 86
+ +I K G Q + + N +++MY KCG+ A ++F+ + +D WN L+ G+V+HGL
Sbjct: 132 IYNHIKKSGVQPDIFMWNTLINMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGL 191

Query: 85 GGEAMKYLERMQQEDVCMDEITYVGSL 5
EA K E+M Q+ V D+ T+V L
Sbjct: 192 YEEAFKLHEQMVQDSVKPDKRTFVSML 218



Score = 76.3 bits (186), Expect = 1e-12
Identities = 44/153 (28%), Positives = 76/153 (49%), Gaps = 1/153 (0%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H + + + + V LI MYT+C +A +F+ L ++ S +MI GYA HG G
Sbjct: 638 HALITEAAFDCDVLVGTGLISMYTKCGSIEDAHQVFHKLPKKNVYSWTSMITGYAQHGRG 697

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
++AL + QMQ EGV + IT V L CA +++G ++ + + +
Sbjct: 698 KEALELFYQMQQEGVKPDWITFVGALSACAHAGLIEEGLHHFQSMKEFNIEPRMEHYGCM 757

Query: 205 VDMYVKCGSLTEACKVFESLLIR-DAALWNTLI 110
VD++ + G L EA + + + D+ +W L+
Sbjct: 758 VDLFGRAGLLNEAVEFIIKMQVEPDSRVWGALL 790


>tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192620 PE=4 SV=1
Length = 902

Score = 144 bits (364), Expect = 3e-33
Identities = 69/187 (36%), Positives = 113/187 (60%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +V++ G+ +++V N L+ MY+ C +A +F+ ++ RD ++ N MI GYA H G
Sbjct: 452 HQQVVEAGLATDAHVGNTLVNMYSMCGSVKDARQVFDRMIQRDIVAYNAMIGGYAAHNLG 511

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
++AL + ++Q EG+ + +T + L CA +++ RE HT + K GF ++ VGNA+
Sbjct: 512 KEALKLFDRLQEEGLKPDKVTYINMLNACANSGSLEWAREIHTLVRKGGFFSDTSVGNAL 571

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
V Y KCGS ++A VFE + R+ WN +I G +HG G +A++ ERM+ E V D
Sbjct: 572 VSTYAKCGSFSDASIVFEKMTKRNVISWNAIIGGSAQHGRGQDALQLFERMKMEGVKPDI 631

Query: 25 ITYVGSL 5
+T+V L
Sbjct: 632 VTFVSLL 638



Score = 142 bits (358), Expect = 1e-32
Identities = 71/187 (37%), Positives = 110/187 (58%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +V K G + V NALI MY+RC +A +F+ +V +D IS MI G A G+G
Sbjct: 351 HSRVAKAGFTSDIGVQNALISMYSRCGSIKDARLVFDKMVRKDVISWTAMIGGLAKSGFG 410

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+AL +Q+MQ GV N +T L C+ ++ GR H +V+ G ++ VGN +
Sbjct: 411 AEALTVYQEMQQAGVEPNRVTYTSILNACSSPAALEWGRRIHQQVVEAGLATDAHVGNTL 470

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
V+MY CGS+ +A +VF+ ++ RD +N +I G+ H LG EA+K +R+Q+E + D+
Sbjct: 471 VNMYSMCGSVKDARQVFDRMIQRDIVAYNAMIGGYAAHNLGKEALKLFDRLQEEGLKPDK 530

Query: 25 ITYVGSL 5
+TY+ L
Sbjct: 531 VTYINML 537



Score = 135 bits (340), Expect = 2e-30
Identities = 69/187 (36%), Positives = 103/187 (55%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +++ G E ++ V AL+ MY +C + + +F LV RD I+ NTMI G A+ GY
Sbjct: 250 HSRILNAGHESDTAVGTALVKMYAKCGSYKDCRQVFEKLVNRDLIAWNTMIGGLAEGGYW 309

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
E+A + QMQ EGV N IT V L C + G+E H+ + K GF + V NA+
Sbjct: 310 EEASEVYNQMQREGVMPNKITYVILLNACVNSAALHWGKEIHSRVAKAGFTSDIGVQNAL 369

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+ MY +CGS+ +A VF+ ++ +D W +I G + G G EA+ + MQQ V +
Sbjct: 370 ISMYSRCGSIKDARLVFDKMVRKDVISWTAMIGGLAKSGFGAEALTVYQEMQQAGVEPNR 429

Query: 25 ITYVGSL 5
+TY L
Sbjct: 430 VTYTSIL 436



Score = 124 bits (311), Expect = 4e-27
Identities = 66/184 (35%), Positives = 102/184 (55%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H + ++ G+ + V+N ++ MY +C EA +F+ + + +S I GYAD G
Sbjct: 149 HFQAMQAGLLFDVKVANCILNMYAKCGSIEEAREVFDKMEKKSVVSWTITIGGYADCGRS 208

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
E A +Q+M+ EGV N IT + L + +K G+ H+ I+ G + ++ VG A+
Sbjct: 209 ETAFEIFQKMEQEGVVPNRITYISVLNAFSSPAALKWGKAVHSRILNAGHESDTAVGTAL 268

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
V MY KCGS + +VFE L+ RD WNT+I G E G EA + +MQ+E V ++
Sbjct: 269 VKMYAKCGSYKDCRQVFEKLVNRDLIAWNTMIGGLAEGGYWEEASEVYNQMQREGVMPNK 328

Query: 25 ITYV 14
ITYV
Sbjct: 329 ITYV 332



Score = 115 bits (289), Expect = 1e-24
Identities = 64/189 (33%), Positives = 99/189 (52%), Gaps = 2/189 (1%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSL--VVRDTISCNTMIAGYADHG 392
H +I+H + Y NALI MY +C EA ++ L + R S N M+ GY +G
Sbjct: 46 HQHIIQHRTVPDQYTVNALINMYIQCGSIEEARQVWKKLSYMERTVHSWNAMVVGYIQYG 105

Query: 391 YGEKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGN 212
Y EKAL +QMQ G+ + T++ L +C ++ GRE H ++ G + V N
Sbjct: 106 YIEKALKLLRQMQQHGLAPDRTTIMSFLSSCKSPGALEWGREIHFQAMQAGLLFDVKVAN 165

Query: 211 AIVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCM 32
I++MY KCGS+ EA +VF+ + + W I G+ + G A + ++M+QE V
Sbjct: 166 CILNMYAKCGSIEEAREVFDKMEKKSVVSWTITIGGYADCGRSETAFEIFQKMEQEGVVP 225

Query: 31 DEITYVGSL 5
+ ITY+ L
Sbjct: 226 NRITYISVL 234



Score = 72.0 bits (175), Expect = 2e-11
Identities = 47/165 (28%), Positives = 83/165 (50%), Gaps = 6/165 (3%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H V K G ++ V NAL+ Y +C F +A +F + R+ IS N +I G A HG G
Sbjct: 553 HTLVRKGGFFSDTSVGNALVSTYAKCGSFSDASIVFEKMTKRNVISWNAIIGGSAQHGRG 612

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVG--- 215
+ AL +++M+ EGV + +T V L C+ +++GR + ++ Q +I+
Sbjct: 613 QDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYFCSM----SQDFAIIPTIE 668

Query: 214 --NAIVDMYVKCGSLTEACKVFESLLIR-DAALWNTLIFGHVEHG 89
+VD+ + G L EA + +++ + + +W L+ HG
Sbjct: 669 HYGCMVDLLGRAGQLDEAEALIKTMPFQANTRIWGALLGACRIHG 713



Score = 71.6 bits (174), Expect = 3e-11
Identities = 35/122 (28%), Positives = 70/122 (57%), Gaps = 2/122 (1%)
Frame = -1

Query: 364 QQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVKC 185
Q +Q +G N+ + L+ C ++++ GR+ H +I++ + NA+++MY++C
Sbjct: 12 QYLQQQGAQVNSSDYMKMLKRCIEVKDLVAGRQVHQHIIQHRTVPDQYTVNALINMYIQC 71

Query: 184 GSLTEACKVFESL--LIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEITYVG 11
GS+ EA +V++ L + R WN ++ G++++G +A+K L +MQQ + D T +
Sbjct: 72 GSIEEARQVWKKLSYMERTVHSWNAMVVGYIQYGYIEKALKLLRQMQQHGLAPDRTTIMS 131

Query: 10 SL 5
L
Sbjct: 132 FL 133


>tr|B8LKN6|B8LKN6_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 394

Score = 142 bits (358), Expect = 1e-32
Identities = 68/183 (37%), Positives = 111/183 (60%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
+D++I G E + V NALI M+ +C +A +F+ + R+ +S M++GYA G+
Sbjct: 136 YDEIISKGCEMDVIVENALINMFMKCGSIEDARRVFDKMCERNLVSWTAMVSGYAQGGFA 195

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
++AL + +MQ E V AN +T+ L CA L ++++G+E H I+++G +VGNA+
Sbjct: 196 DEALRMFYEMQGEDVKANYVTVASVLPACAQLSDLQQGKEIHGYIIRRGLDLGIVVGNAL 255

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+DMY KCGS+ A KVF+ +L RD WN I G+ ++G E M+ +MQ + +D
Sbjct: 256 IDMYAKCGSIGSAQKVFDKMLQRDVVSWNVAIAGYAQNGRFDECMELFRKMQCAGLKIDV 315

Query: 25 ITY 17
IT+
Sbjct: 316 ITW 318



Score = 107 bits (266), Expect = 6e-22
Identities = 58/188 (30%), Positives = 97/188 (51%), Gaps = 1/188 (0%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++ GI R V L+ +Y +C +A F+++ D N MI GY HG
Sbjct: 34 HAHMLLTGILRIPSVETKLLNLYVKCGSLPDARLAFDNMTKGDVFPWNVMIGGYVKHGET 93

Query: 385 EKALACWQQMQSEGVT-ANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNA 209
+AL + QMQ T + T L CA L ++ +G+ + I+ KG + + IV NA
Sbjct: 94 REALELYHQMQKVSSTNPDNYTYSSVLNACARLASLSEGKLIYDEIISKGCEMDVIVENA 153

Query: 208 IVDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMD 29
+++M++KCGS+ +A +VF+ + R+ W ++ G+ + G EA++ MQ EDV +
Sbjct: 154 LINMFMKCGSIEDARRVFDKMCERNLVSWTAMVSGYAQGGFADEALRMFYEMQGEDVKAN 213

Query: 28 EITYVGSL 5
+T L
Sbjct: 214 YVTVASVL 221



Score = 81.3 bits (199), Expect = 3e-14
Identities = 46/158 (29%), Positives = 74/158 (46%), Gaps = 35/158 (22%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHG-- 392
H +I+ G++ V NALI MY +C A+ +F+ ++ RD +S N IAGYA +G
Sbjct: 237 HGYIIRRGLDLGIVVGNALIDMYAKCGSIGSAQKVFDKMLQRDVVSWNVAIAGYAQNGRF 296

Query: 391 ---------------------------------YGEKALACWQQMQSEGVTANAITLVCG 311
YG++ L +QQMQ GV N+IT+
Sbjct: 297 DECMELFRKMQCAGLKIDVITWNTLITAYAQNGYGDQTLELFQQMQLRGVKPNSITIASV 356

Query: 310 LQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDM 197
L CA + +++G+ H + + + + VGNA++DM
Sbjct: 357 LSACAAVSALQEGKRIHDLVNRSECKSDICVGNALIDM 394



Score = 55.1 bits (131), Expect = 3e-06
Identities = 26/88 (29%), Positives = 49/88 (55%)
Frame = -1

Query: 310 LQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVKCGSLTEACKVFESLLIRDA 131
L C + + + ++ H +++ G V ++++YVKCGSL +A F+++ D
Sbjct: 18 LHLCTKAKTLAEAKQVHAHMLLTGILRIPSVETKLLNLYVKCGSLPDARLAFDNMTKGDV 77

Query: 130 ALWNTLIFGHVEHGLGGEAMKYLERMQQ 47
WN +I G+V+HG EA++ +MQ+
Sbjct: 78 FPWNVMIGGYVKHGETREALELYHQMQK 105


>tr|A9RSU9|A9RSU9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_177829 PE=4 SV=1
Length = 527

Score = 137 bits (346), Expect = 3e-31
Identities = 69/187 (36%), Positives = 108/187 (57%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
HD ++K G+++N YV+N L+ +Y RC +A ++F+ LV ++ + TMI GYA+HG
Sbjct: 22 HDCILKSGMDQNPYVANKLMRVYIRCGKVQDARHVFDKLVKKNVFNWTTMIGGYAEHGRP 81

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
A+ + QM+ EG N +T + L+ CA +K G+E H +I GF+ + V A+
Sbjct: 82 ADAIEVYNQMRQEGGRPNEVTYLSILKACACPVGLKWGKEIHAHISHGGFRSDVPVQTAL 141

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
V+MY K GS+ +A VF+ + R+ WN +I G +HG G EA +MQ+E D
Sbjct: 142 VNMYAKSGSIKDARLVFDEMAERNVITWNVMIGGLAQHGFGQEAFSLFLQMQEEGFVPDS 201

Query: 25 ITYVGSL 5
TY+ L
Sbjct: 202 TTYLSIL 208



Score = 116 bits (291), Expect = 7e-25
Identities = 65/187 (34%), Positives = 101/187 (54%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +K G + + V NAL+++Y++ +A +F ++ RD IS + MI G A +G G
Sbjct: 226 HRHAVKAGFDSDMRVCNALVHVYSKSGSVDDARLVFEGMLDRDVISWSAMIGGLAQNGCG 285

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+A + + +MQ EGV N T V L A ++ ++ H + K G + V NA+
Sbjct: 286 HEAFSLFLKMQREGVIPNVTTYVSILTASASAGALEWVKQVHNHARKAGLGSDFRVCNAL 345

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
V MY K GS+ +A VF+ + +R+ WN +I G +HG G EA RM++E V D
Sbjct: 346 VHMYAKSGSIDDARLVFDQMSVRNVFTWNAMIGGLAQHGCGQEAFSLFLRMRREGVVPDA 405

Query: 25 ITYVGSL 5
ITY+ L
Sbjct: 406 ITYMSIL 412



Score = 109 bits (273), Expect = 9e-23
Identities = 67/186 (36%), Positives = 99/186 (53%), Gaps = 3/186 (1%)
Frame = -1

Query: 553 IKHGIERNSY-VSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGEKA 377
I HG R+ V AL+ MY + +A +F+ + R+ I+ N MI G A HG+G++A
Sbjct: 126 ISHGGFRSDVPVQTALVNMYAKSGSIKDARLVFDEMAERNVITWNVMIGGLAQHGFGQEA 185

Query: 376 LACWQQMQSEGVTANAITLVCGLQTCAILENVKKG--REFHTNIVKKGFQGESIVGNAIV 203
+ + QMQ EG ++ T + L A G +E H + VK GF + V NA+V
Sbjct: 186 FSLFLQMQEEGFVPDSTTYLSILTATACSSAGALGWVKEVHRHAVKAGFDSDMRVCNALV 245

Query: 202 DMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEI 23
+Y K GS+ +A VFE +L RD W+ +I G ++G G EA +MQ+E V +
Sbjct: 246 HVYSKSGSVDDARLVFEGMLDRDVISWSAMIGGLAQNGCGHEAFSLFLKMQREGVIPNVT 305

Query: 22 TYVGSL 5
TYV L
Sbjct: 306 TYVSIL 311



Score = 107 bits (268), Expect = 3e-22
Identities = 61/187 (32%), Positives = 98/187 (52%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H+ K G+ + V NAL++MY + +A +F+ + VR+ + N MI G A HG G
Sbjct: 327 HNHARKAGLGSDFRVCNALVHMYAKSGSIDDARLVFDQMSVRNVFTWNAMIGGLAQHGCG 386

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
++A + + +M+ EGV +AIT + L A + +E H V+ G + VGNA+
Sbjct: 387 QEAFSLFLRMRREGVVPDAITYMSILNASASTGALGWVKEVHRQAVQAGLDSDVRVGNAL 446

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
V MY K GS+++A +F+ ++ RD W +I G ++ G EA +MQ+E
Sbjct: 447 VHMYCKTGSISDARLMFDGMVERDVITWTAMISGLAQNECGQEAFSLFLQMQREGFIPVA 506

Query: 25 ITYVGSL 5
TY L
Sbjct: 507 TTYASIL 513



Score = 67.8 bits (164), Expect = 4e-10
Identities = 32/103 (31%), Positives = 59/103 (57%)
Frame = -1

Query: 310 LQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVKCGSLTEACKVFESLLIRDA 131
LQ C +++ ++ H I+K G V N ++ +Y++CG + +A VF+ L+ ++
Sbjct: 6 LQRCFKHKDLTSVKQVHDCILKSGMDQNPYVANKLMRVYIRCGKVQDARHVFDKLVKKNV 65

Query: 130 ALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEITYVGSLK 2
W T+I G+ EHG +A++ +M+QE +E+TY+ LK
Sbjct: 66 FNWTTMIGGYAEHGRPADAIEVYNQMRQEGGRPNEVTYLSILK 108



Score = 57.4 bits (137), Expect = 5e-07
Identities = 29/89 (32%), Positives = 49/89 (55%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H + ++ G++ + V NAL++MY + +A +F+ +V RD I+ MI+G A + G
Sbjct: 428 HRQAVQAGLDSDVRVGNALVHMYCKTGSISDARLMFDGMVERDVITWTAMISGLAQNECG 487

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTC 299
++A + + QMQ EG A T L C
Sbjct: 488 QEAFSLFLQMQREGFIPVATTYASILNVC 516


>tr|A9TDA2|A9TDA2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_169414 PE=4 SV=1
Length = 703

Score = 134 bits (338), Expect = 3e-30
Identities = 71/187 (37%), Positives = 111/187 (59%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
HD +IK +E+N++V N L+++Y C EA +F++LV + S N MIAGY +H +
Sbjct: 51 HDCIIKSRMEQNAHVMNNLLHVYIECGRLQEARCVFDALVKKSGASWNAMIAGYVEHKHA 110

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
E A+ +++M EGV NA T + L+ CA L +K G+E H I G + + VG A+
Sbjct: 111 EDAMRLFREMCHEGVQPNAGTYMIILKACASLSALKWGKEVHACIRHGGLESDVRVGTAL 170

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+ MY KCGS+ EA ++F++L+ D W +I + + G G EA + + +M+QE +
Sbjct: 171 LRMYGKCGSINEARRIFDNLMNHDIISWTVMIGAYAQSGNGKEAYRLMLQMEQEGFKPNA 230

Query: 25 ITYVGSL 5
ITYV L
Sbjct: 231 ITYVSIL 237



Score = 119 bits (299), Expect = 9e-26
Identities = 63/187 (33%), Positives = 102/187 (54%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H + G+E + V AL+ MY + +A +F+ + VRD +S N MI +A+HG G
Sbjct: 253 HRHALDAGLELDVRVGTALVQMYAKSGSIDDARVVFDRMKVRDVVSWNVMIGAFAEHGRG 312

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+A + QMQ+EG +AI + L CA ++ ++ H + + G + + VG A+
Sbjct: 313 HEAYDLFLQMQTEGCKPDAIMFLSILNACASAGALEWVKKIHRHALDSGLEVDVRVGTAL 372

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
V MY K GS+ +A VF+ + +R+ WN +I G +HGLG +A++ RM V D
Sbjct: 373 VHMYSKSGSIDDARVVFDRMKVRNVVSWNAMISGLAQHGLGQDALEVFRRMTAHGVKPDR 432

Query: 25 ITYVGSL 5
+T+V L
Sbjct: 433 VTFVAVL 439



Score = 115 bits (288), Expect = 2e-24
Identities = 68/184 (36%), Positives = 96/184 (52%), Gaps = 1/184 (0%)
Frame = -1

Query: 553 IKHG-IERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGEKA 377
I+HG +E + V AL+ MY +C EA +F++L+ D IS MI YA G G++A
Sbjct: 155 IRHGGLESDVRVGTALLRMYGKCGSINEARRIFDNLMNHDIISWTVMIGAYAQSGNGKEA 214

Query: 376 LACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDM 197
QM+ EG NAIT V L CA +K + H + + G + + VG A+V M
Sbjct: 215 YRLMLQMEQEGFKPNAITYVSILNACASEGALKWVKRVHRHALDAGLELDVRVGTALVQM 274

Query: 196 YVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEITY 17
Y K GS+ +A VF+ + +RD WN +I EHG G EA +MQ E D I +
Sbjct: 275 YAKSGSIDDARVVFDRMKVRDVVSWNVMIGAFAEHGRGHEAYDLFLQMQTEGCKPDAIMF 334

Query: 16 VGSL 5
+ L
Sbjct: 335 LSIL 338



Score = 78.6 bits (192), Expect = 2e-13
Identities = 49/166 (29%), Positives = 87/166 (52%), Gaps = 7/166 (4%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H + G+E + V AL++MY++ +A +F+ + VR+ +S N MI+G A HG G
Sbjct: 354 HRHALDSGLEVDVRVGTALVHMYSKSGSIDDARVVFDRMKVRNVVSWNAMISGLAQHGLG 413

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVK-KGFQGESIVGNA 209
+ AL +++M + GV + +T V L C+ V +GR + + + G + + N
Sbjct: 414 QDALEVFRRMTAHGVKPDRVTFVAVLSACSHAGLVDEGRSQYLAMTQVYGIEPDVSHCNC 473

Query: 208 IVDMYVKCGSLTEACKVFESLLI-RDAALWNTLI-----FGHVEHG 89
+VD+ + G L EA +++ + D A W L+ +G+VE G
Sbjct: 474 MVDLLGRAGRLMEAKLFIDNMAVDPDEATWGALLGSCRTYGNVELG 519



Score = 63.5 bits (153), Expect = 8e-09
Identities = 36/127 (28%), Positives = 65/127 (51%)
Frame = -1

Query: 382 KALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIV 203
+A+ G+ ++ V L+ C +++ ++ H I+K + + V N ++
Sbjct: 11 EAIVVLMNRLQRGLITDSFMYVEVLKRCLKQKDLMAAKQVHDCIIKSRMEQNAHVMNNLL 70

Query: 202 DMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEI 23
+Y++CG L EA VF++L+ + A WN +I G+VEH +AM+ M E V +
Sbjct: 71 HVYIECGRLQEARCVFDALVKKSGASWNAMIAGYVEHKHAEDAMRLFREMCHEGVQPNAG 130

Query: 22 TYVGSLK 2
TY+ LK
Sbjct: 131 TYMIILK 137


>tr|A9SQ58|A9SQ58_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_133419 PE=4 SV=1
Length = 505

Score = 134 bits (338), Expect = 3e-30
Identities = 67/188 (35%), Positives = 110/188 (58%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++K G E + V AL+ M+++C ++A +F L R+ +S ++I+ YA G
Sbjct: 271 HSVIMKAGFELDVRVGTALVNMFSKCGSVVDALKVFQKLPQRNVVSWTSVISAYAQAGEP 330

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
E+AL C+ +M +EG+ A+ L CA+L +++KG+ H +IV+ G + I N +
Sbjct: 331 ERALECYAKMLNEGMVADKRAYTTILNVCAMLGDIEKGKAVHGHIVQSGIATDIITENGL 390

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+DMYVKCG L +A ++F+ + +RD W TLI G V+H EA+ MQ E V +
Sbjct: 391 IDMYVKCGRLKDAYRLFQDMNVRDVVSWTTLIEGWVQHRQYQEALDTFNDMQLEGVMPNT 450

Query: 25 ITYVGSLK 2
+T++G LK
Sbjct: 451 VTFLGVLK 458



Score = 132 bits (333), Expect = 1e-29
Identities = 64/187 (34%), Positives = 106/187 (56%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H + K ++V NAL+ MY +C ++A +F+ +V RD + M+ GYA GY
Sbjct: 72 HAHMAKSDFVPTTFVLNALVNMYMKCGSLVDARQVFDRMVERDMFTYTMMLTGYAKLGYP 131

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
E A ++QMQ E V + IT L C+ L +++KG + H ++V+ G + + I+GN +
Sbjct: 132 EDAYKMYEQMQKERVPVDRITFTTILNVCSTLRSLEKGMKVHQDMVRGGIRPDIILGNTL 191

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+DMY KCG+L +A +VF+ + RD WN ++ G +G EA ++ + M E D+
Sbjct: 192 IDMYAKCGNLKQAHRVFKEMDNRDIVTWNIMVGGAARNGYFDEAFEFFKAMLDEGQKPDK 251

Query: 25 ITYVGSL 5
+TY+ L
Sbjct: 252 VTYISIL 258



Score = 105 bits (261), Expect = 2e-21
Identities = 57/183 (31%), Positives = 98/183 (53%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +++ GI + + N LI MY +C +A +F + RD ++ N M+ G A +GY
Sbjct: 173 HQDMVRGGIRPDIILGNTLIDMYAKCGNLKQAHRVFKEMDNRDIVTWNIMVGGAARNGYF 232

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
++A ++ M EG + +T + L C LE +G H+ I+K GF+ + VG A+
Sbjct: 233 DEAFEFFKAMLDEGQKPDKVTYISILNACTSLE---QGTLLHSVIMKAGFELDVRVGTAL 289

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
V+M+ KCGS+ +A KVF+ L R+ W ++I + + G A++ +M E + D+
Sbjct: 290 VNMFSKCGSVVDALKVFQKLPQRNVVSWTSVISAYAQAGEPERALECYAKMLNEGMVADK 349

Query: 25 ITY 17
Y
Sbjct: 350 RAY 352



Score = 89.4 bits (220), Expect = 1e-16
Identities = 45/133 (33%), Positives = 70/133 (52%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +++ GI + N LI MY +C +A LF + VRD +S T+I G+ H
Sbjct: 372 HGHIVQSGIATDIITENGLIDMYVKCGRLKDAYRLFQDMNVRDVVSWTTLIEGWVQHRQY 431

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
++AL + MQ EGV N +T + L+ CA + ++ G+ H IV+ G + + +A+
Sbjct: 432 QEALDTFNDMQLEGVMPNTVTFLGVLKACAGMGSLVDGKRIHARIVEAGLAENAHIRHAL 491

Query: 205 VDMYVKCGSLTEA 167
DMY KC S A
Sbjct: 492 ADMYAKCDSCGNA 504



Score = 79.3 bits (194), Expect = 1e-13
Identities = 37/114 (32%), Positives = 70/114 (61%)
Frame = -1

Query: 358 MQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVKCGS 179
++ G+ ++ VC L+ C ++++ +G+ H ++ K F + V NA+V+MY+KCGS
Sbjct: 40 LEQRGIEPSSYAYVCLLRRCTHMKDLAEGKYVHAHMAKSDFVPTTFVLNALVNMYMKCGS 99

Query: 178 LTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEITY 17
L +A +VF+ ++ RD + ++ G+ + G +A K E+MQ+E V +D IT+
Sbjct: 100 LVDARQVFDRMVERDMFTYTMMLTGYAKLGYPEDAYKMYEQMQKERVPVDRITF 153


>tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 SV=2
Length = 1106

Score = 134 bits (337), Expect = 3e-30
Identities = 70/188 (37%), Positives = 110/188 (58%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H+ +++ GI+ N +++NAL+ MY RC +EA+N+F RD IS N+MIAG+A HG
Sbjct: 454 HEDILRSGIKSNGHLANALMNMYRRCGSLMEAQNVFEGTQARDVISWNSMIAGHAQHGSY 513

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
E A +Q+MQ+E + + IT L C E ++ G++ H I + G Q + +GNA+
Sbjct: 514 ETAYKLFQEMQNEELEPDNITFASVLSGCKNPEALELGKQIHGRITESGLQLDVNLGNAL 573

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
++MY++CGSL +A VF SL RD W +I G + G +A++ +MQ E +
Sbjct: 574 INMYIRCGSLQDARNVFHSLQHRDVMSWTAMIGGCADQGEDMKAIELFWQMQNEGFRPVK 633

Query: 25 ITYVGSLK 2
T+ LK
Sbjct: 634 STFSSILK 641



Score = 129 bits (325), Expect = 9e-29
Identities = 70/187 (37%), Positives = 101/187 (54%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H + + G + + NALI MY RC +A LF ++ RD IS N +IAGYA
Sbjct: 353 HSHISEDGHSSDVQIGNALISMYARCGDLPKARELFYTMPKRDLISWNAIIAGYARREDR 412

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+A+ ++QMQSEGV +T + L CA G+ H +I++ G + + NA+
Sbjct: 413 GEAMRLYKQMQSEGVKPGRVTFLHLLSACANSSAYADGKMIHEDILRSGIKSNGHLANAL 472

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
++MY +CGSL EA VFE RD WN++I GH +HG A K + MQ E++ D
Sbjct: 473 MNMYRRCGSLMEAQNVFEGTQARDVISWNSMIAGHAQHGSYETAYKLFQEMQNEELEPDN 532

Query: 25 ITYVGSL 5
IT+ L
Sbjct: 533 ITFASVL 539



Score = 127 bits (318), Expect = 6e-28
Identities = 62/184 (33%), Positives = 105/184 (57%)
Frame = -1

Query: 556 VIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYGEKA 377
++ G E ++ V NALI Y++ +A +F+ + RD +S N +IAGYA +G G+ A
Sbjct: 659 ILNSGYELDTGVGNALISAYSKSGSMTDAREVFDKMPSRDIVSWNKIIAGYAQNGLGQTA 718

Query: 376 LACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDM 197
+ QMQ + V N + V L C+ +++G+ H IVK+ QG+ VG A++ M
Sbjct: 719 VEFAYQMQEQDVVPNKFSFVSLLNACSSFSALEEGKRVHAEIVKRKLQGDVRVGAALISM 778

Query: 196 YVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEITY 17
Y KCGS EA +VF++++ ++ WN +I + +HGL +A+ + M++E + D T+
Sbjct: 779 YAKCGSQGEAQEVFDNIIEKNVVTWNAMINAYAQHGLASKALGFFNCMEKEGIKPDGSTF 838

Query: 16 VGSL 5
L
Sbjct: 839 TSIL 842



Score = 125 bits (313), Expect = 2e-27
Identities = 65/187 (34%), Positives = 110/187 (58%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++ + G++ + + NALI MY RC +A N+F+SL RD +S MI G AD G
Sbjct: 555 HGRITESGLQLDVNLGNALINMYIRCGSLQDARNVFHSLQHRDVMSWTAMIGGCADQGED 614

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
KA+ + QMQ+EG T L+ C + +G++ I+ G++ ++ VGNA+
Sbjct: 615 MKAIELFWQMQNEGFRPVKSTFSSILKVCTSSACLDEGKKVIAYILNSGYELDTGVGNAL 674

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+ Y K GS+T+A +VF+ + RD WN +I G+ ++GLG A+++ +MQ++DV ++
Sbjct: 675 ISAYSKSGSMTDAREVFDKMPSRDIVSWNKIIAGYAQNGLGQTAVEFAYQMQEQDVVPNK 734

Query: 25 ITYVGSL 5
++V L
Sbjct: 735 FSFVSLL 741



Score = 119 bits (298), Expect = 1e-25
Identities = 58/187 (31%), Positives = 105/187 (56%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++++ + + ++SN LI MY +CR ++A +F + RD IS N++I+ YA G+
Sbjct: 50 HAQMVEAWVGPDIFLSNLLINMYVKCRSVLDAHQVFKEMPRRDVISWNSLISCYAQQGFK 109

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+KA +++MQ+ G N IT + L C ++ G++ H+ I+K G+Q + V N++
Sbjct: 110 KKAFQLFEEMQNAGFIPNKITYISILTACYSPAELENGKKIHSQIIKAGYQRDPRVQNSL 169

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+ MY KCG L A +VF + RD +NT++ + + E + +M E + D+
Sbjct: 170 LSMYGKCGDLPRARQVFAGISPRDVVSYNTMLGLYAQKAYVKECLGLFGQMSSEGISPDK 229

Query: 25 ITYVGSL 5
+TY+ L
Sbjct: 230 VTYINLL 236



Score = 112 bits (279), Expect = 2e-23
Identities = 59/187 (31%), Positives = 98/187 (52%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++IK G +R+ V N+L+ MY +C A +F + RD +S NTM+ YA Y
Sbjct: 151 HSQIIKAGYQRDPRVQNSLLSMYGKCGDLPRARQVFAGISPRDVVSYNTMLGLYAQKAYV 210

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
++ L + QM SEG++ + +T + L + +G+ H V++G + VG A+
Sbjct: 211 KECLGLFGQMSSEGISPDKVTYINLLDAFTTPSMLDEGKRIHKLTVEEGLNSDIRVGTAL 270

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
V M V+CG + A + F+ RD ++N LI +HG EA + RM+ + V ++
Sbjct: 271 VTMCVRCGDVDSAKQAFKGTADRDVVVYNALIAALAQHGHNVEAFEQYYRMRSDGVALNR 330

Query: 25 ITYVGSL 5
TY+ L
Sbjct: 331 TTYLSIL 337



Score = 110 bits (276), Expect = 4e-23
Identities = 56/184 (30%), Positives = 97/184 (52%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++ G+ + V AL+ M RC A+ F RD + N +IA A HG+
Sbjct: 252 HKLTVEEGLNSDIRVGTALVTMCVRCGDVDSAKQAFKGTADRDVVVYNALIAALAQHGHN 311

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+A + +M+S+GV N T + L C+ + ++ G+ H++I + G + +GNA+
Sbjct: 312 VEAFEQYYRMRSDGVALNRTTYLSILNACSTSKALEAGKLIHSHISEDGHSSDVQIGNAL 371

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+ MY +CG L +A ++F ++ RD WN +I G+ GEAM+ ++MQ E V
Sbjct: 372 ISMYARCGDLPKARELFYTMPKRDLISWNAIIAGYARREDRGEAMRLYKQMQSEGVKPGR 431

Query: 25 ITYV 14
+T++
Sbjct: 432 VTFL 435



Score = 63.2 bits (152), Expect = 1e-08
Identities = 46/172 (26%), Positives = 77/172 (44%), Gaps = 13/172 (7%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H +++K ++ + V ALI MY +C EA+ +F++++ ++ ++ N MI YA HG
Sbjct: 757 HAEIVKRKLQGDVRVGAALISMYAKCGSQGEAQEVFDNIIEKNVVTWNAMINAYAQHGLA 816

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQ----GESIV 218
KAL + M+ EG+ + T L C H +V +G+Q ES
Sbjct: 817 SKALGFFNCMEKEGIKPDGSTFTSILSACN-----------HAGLVLEGYQIFSSMESEY 865

Query: 217 G--------NAIVDMYVKCGSLTEACKVFESL-LIRDAALWNTLIFGHVEHG 89
G +V + + EA + + DAA+W TL+ HG
Sbjct: 866 GVLPTIEHYGCLVGLLGRARRFQEAETLINQMPFPPDAAVWETLLGACRIHG 917



Score = 62.4 bits (150), Expect = 2e-08
Identities = 32/107 (29%), Positives = 55/107 (51%)
Frame = -1

Query: 325 TLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVKCGSLTEACKVFESL 146
T V LQ C + + + H +V+ + + N +++MYVKC S+ +A +VF+ +
Sbjct: 29 TYVALLQNCTRKRLLPEAKRIHAQMVEAWVGPDIFLSNLLINMYVKCRSVLDAHQVFKEM 88

Query: 145 LIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEITYVGSL 5
RD WN+LI + + G +A + E MQ ++ITY+ L
Sbjct: 89 PRRDVISWNSLISCYAQQGFKKKAFQLFEEMQNAGFIPNKITYISIL 135


>tr|A9T5P5|A9T5P5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_191892 PE=4 SV=1
Length = 905

Score = 133 bits (335), Expect = 6e-30
Identities = 67/174 (38%), Positives = 105/174 (60%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H+ +++ GI+ N +++NAL+ MY RC +EA+N+F RD IS N+MIAG+A HG
Sbjct: 454 HEDILRSGIKSNGHLANALMNMYRRCGSLMEAQNVFEGTQARDVISWNSMIAGHAQHGSY 513

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
E A +Q+MQ+E + + IT L C E ++ G++ H I + G Q + +GNA+
Sbjct: 514 ETAYKLFQEMQNEELEPDNITFASVLSGCKNPEALELGKQIHGRITESGLQLDVNLGNAL 573

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQE 44
++MY++CGSL +A VF SL RD W +I G + G +A++ +MQ E
Sbjct: 574 INMYIRCGSLQDARNVFHSLQHRDVMSWTAMIGGCADQGEDMKAIELFWQMQNE 627



Score = 129 bits (325), Expect = 9e-29
Identities = 70/187 (37%), Positives = 101/187 (54%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H + + G + + NALI MY RC +A LF ++ RD IS N +IAGYA
Sbjct: 353 HSHISEDGHSSDVQIGNALISMYARCGDLPKARELFYTMPKRDLISWNAIIAGYARREDR 412

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+A+ ++QMQSEGV +T + L CA G+ H +I++ G + + NA+
Sbjct: 413 GEAMRLYKQMQSEGVKPGRVTFLHLLSACANSSAYADGKMIHEDILRSGIKSNGHLANAL 472

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
++MY +CGSL EA VFE RD WN++I GH +HG A K + MQ E++ D
Sbjct: 473 MNMYRRCGSLMEAQNVFEGTQARDVISWNSMIAGHAQHGSYETAYKLFQEMQNEELEPDN 532

Query: 25 ITYVGSL 5
IT+ L
Sbjct: 533 ITFASVL 539



Score = 122 bits (306), Expect = 1e-26
Identities = 59/187 (31%), Positives = 106/187 (56%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++++ G+ + ++SN LI MY +CR ++A +F + RD IS N++I+ YA G+
Sbjct: 50 HAQMVEAGVGPDIFLSNLLINMYVKCRSVLDAHQVFKEMPRRDVISWNSLISCYAQQGFK 109

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+KA +++MQ+ G N IT + L C ++ G++ H+ I+K G+Q + V N++
Sbjct: 110 KKAFQLFEEMQNAGFIPNKITYISILTACYSPAELENGKKIHSQIIKAGYQRDPRVQNSL 169

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+ MY KCG L A +VF + RD +NT++ + + E + +M E + D+
Sbjct: 170 LSMYGKCGDLPRARQVFAGISPRDVVSYNTMLGLYAQKAYVKECLGLFGQMSSEGISPDK 229

Query: 25 ITYVGSL 5
+TY+ L
Sbjct: 230 VTYINLL 236



Score = 113 bits (282), Expect = 8e-24
Identities = 59/187 (31%), Positives = 99/187 (52%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++IK G +R+ V N+L+ MY +C A +F + RD +S NTM+ YA Y
Sbjct: 151 HSQIIKAGYQRDPRVQNSLLSMYGKCGDLPRARQVFAGISPRDVVSYNTMLGLYAQKAYV 210

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
++ L + QM SEG++ + +T + L + +G+ H V++G + VG A+
Sbjct: 211 KECLGLFGQMSSEGISPDKVTYINLLDAFTTPSMLDEGKRIHKLTVEEGLNSDIRVGTAL 270

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
V M V+CG + A + F+ + RD ++N LI +HG EA + RM+ + V ++
Sbjct: 271 VTMCVRCGDVDSAKQAFKGIADRDVVVYNALIAALAQHGHNVEAFEQYYRMRSDGVALNR 330

Query: 25 ITYVGSL 5
TY+ L
Sbjct: 331 TTYLSIL 337



Score = 112 bits (279), Expect = 2e-23
Identities = 56/184 (30%), Positives = 98/184 (53%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++ G+ + V AL+ M RC A+ F + RD + N +IA A HG+
Sbjct: 252 HKLTVEEGLNSDIRVGTALVTMCVRCGDVDSAKQAFKGIADRDVVVYNALIAALAQHGHN 311

Query: 385 EKALACWQQMQSEGVTANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAI 206
+A + +M+S+GV N T + L C+ + ++ G+ H++I + G + +GNA+
Sbjct: 312 VEAFEQYYRMRSDGVALNRTTYLSILNACSTSKALEAGKLIHSHISEDGHSSDVQIGNAL 371

Query: 205 VDMYVKCGSLTEACKVFESLLIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDE 26
+ MY +CG L +A ++F ++ RD WN +I G+ GEAM+ ++MQ E V
Sbjct: 372 ISMYARCGDLPKARELFYTMPKRDLISWNAIIAGYARREDRGEAMRLYKQMQSEGVKPGR 431

Query: 25 ITYV 14
+T++
Sbjct: 432 VTFL 435



Score = 65.5 bits (158), Expect = 2e-09
Identities = 33/107 (30%), Positives = 56/107 (52%)
Frame = -1

Query: 325 TLVCGLQTCAILENVKKGREFHTNIVKKGFQGESIVGNAIVDMYVKCGSLTEACKVFESL 146
T V LQ C + + + H +V+ G + + N +++MYVKC S+ +A +VF+ +
Sbjct: 29 TYVALLQNCTRKRLLPEAKRIHAQMVEAGVGPDIFLSNLLINMYVKCRSVLDAHQVFKEM 88

Query: 145 LIRDAALWNTLIFGHVEHGLGGEAMKYLERMQQEDVCMDEITYVGSL 5
RD WN+LI + + G +A + E MQ ++ITY+ L
Sbjct: 89 PRRDVISWNSLISCYAQQGFKKKAFQLFEEMQNAGFIPNKITYISIL 135



Score = 63.2 bits (152), Expect = 1e-08
Identities = 52/173 (30%), Positives = 77/173 (44%), Gaps = 14/173 (8%)
Frame = -1

Query: 565 HDKVIKHGIERNSYVSNALIYMYTRCRMFIEAENLFNSLVVRDTISCNTMIAGYADHGYG 386
H ++ + G++ + + NALI MY RC +A N+F+SL RD +S MI G AD G
Sbjct: 555 HGRITESGLQLDVNLGNALINMYIRCGSLQDARNVFHSLQHRDVMSWTAMIGGCADQGED 614

Query: 385 EKALACWQQMQSEGV-TANAITLVCGLQTCAILENVKKGREFHTNIVKKGFQ----GESI 221
KA+ + QMQ+EG + T L C H +V +G+Q ES
Sbjct: 615 MKAIELFWQMQNEGFRPPDGSTFTSILSACN-----------HAGLVLEGYQIFSSMESE 663

Query: 220 VG--------NAIVDMYVKCGSLTEACKVFESL-LIRDAALWNTLIFGHVEHG 89
G +V + + EA + + DAA+W TL+ HG
Sbjct: 664 YGVLPTIEHYGCLVGLLGRARRFQEAETLINQMPFPPDAAVWETLLGACRIHG 716