BP918672
Clone id YMU001_000116_B12
Library
Length 554
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000116_B12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GATCAACACCTCCCTCTACCACAGTACCACTCCAGCTCTTGGATGACTTAACTATCCCCA
TAAACCCTTATGAACTATTTGCCTTTGCTGGAGCTTTATGTTAGCTGTAAAGCTGCAAGC
ACTTATCACTAGAGAATCCATCTTTCAACCAACATTTGTCACAACCTGTGTTGGGTTCTG
AAGCACAGCCCAGATGATTTTTCAACTGTTGGTGATGAGCAGATAACCCAAAGCATCGTA
TTCAAACACCGTGGAACCTGCATAGCCTGCTGAATTTGCCCTTCTTTGACCAACTACACT
CGAACTCCACAGAAAGTATAGCTAAGCGCCTCACGAATGCCACCATTGAAATCTGAAGAA
TCTGCAGTTCATGCTTGACCTTACCAGTCTAATGAGGCAAGACAAAAGAACCAATTCCGG
TTCGTCTTAGCCCTTTAGGTCCAGCAACAAGTCGAACGAGGGAAAGCAACCCATGCATCT
CACTGAAATCATCATTCCCCGCTGCAATGTATAGACTCATAAATGATATTGCATAGTATA
CACGATCAGGAACT
■■Homology search results ■■ -
sp_hit_id Q6P3X8
Definition sp|Q6P3X8|PGBD2_HUMAN PiggyBac transposable element-derived protein 2 OS=Homo sapiens
Align length 75
Score (bit) 30.0
E-value 7.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918672|Adiantum capillus-veneris mRNA, clone:
YMU001_000116_B12.
(554 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6P3X8|PGBD2_HUMAN PiggyBac transposable element-derived prot... 30 7.9

>sp|Q6P3X8|PGBD2_HUMAN PiggyBac transposable element-derived protein
2 OS=Homo sapiens GN=PGBD2 PE=2 SV=1
Length = 592

Score = 30.0 bits (66), Expect = 7.9
Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 4/75 (5%)
Frame = -2

Query: 364 QILQISMVAFVRRLAILSVEFECSWSKKGKFSRLCRFHGV*IRCFGLSAH---HQQLKNH 194
Q Q+ ++AF R +A + +E + +G+ SR F + H HQ +
Sbjct: 507 QDAQVDLLAFRRYIACVYLESNADTTSQGRRSRRLETESR----FDMIGHWIIHQDKRTR 562

Query: 193 LG-CASEPNTGCDKC 152
C S+ NT C+KC
Sbjct: 563 CALCHSQTNTRCEKC 577


tr_hit_id Q8L0X1
Definition tr|Q8L0X1|Q8L0X1_9GAMM Acyl-CoA dehydrogenase B OS=Acinetobacter sp. M-1
Align length 74
Score (bit) 39.3
E-value 0.14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918672|Adiantum capillus-veneris mRNA, clone:
YMU001_000116_B12.
(554 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8L0X1|Q8L0X1_9GAMM Acyl-CoA dehydrogenase B OS=Acinetobacter... 39 0.14
tr|A3TT84|A3TT84_9RHOB Acyl-CoA dehydrogenase family protein OS=... 35 2.7
tr|A3SI50|A3SI50_9RHOB Acyl-CoA dehydrogenase family protein OS=... 35 3.5
tr|A8LRD4|A8LRD4_DINSH Acyl-CoA dehydrogenase domain protein OS=... 34 4.6
tr|Q63X89|Q63X89_BURPS Putative acyl-CoA dehydrogenase oxidoredu... 34 6.0
tr|Q3JVY3|Q3JVY3_BURP1 Acyl-CoA dehydrogenase domain protein OS=... 34 6.0
tr|Q2T128|Q2T128_BURTA Acyl-CoA dehydrogenase domain protein OS=... 34 6.0
tr|A3NRK6|A3NRK6_BURP0 Acyl-CoA dehydrogenase domain protein OS=... 34 6.0
tr|A3N5W1|A3N5W1_BURP6 Acyl-CoA dehydrogenase domain protein OS=... 34 6.0
tr|B7CJ51|B7CJ51_BURPS Acyl-CoA dehydrogenase domain protein OS=... 34 6.0
tr|B1HFR3|B1HFR3_BURPS Acyl-CoA dehydrogenase domain protein OS=... 34 6.0
tr|A8KIR2|A8KIR2_BURPS Acyl-CoA dehydrogenase domain protein OS=... 34 6.0
tr|A8E9K7|A8E9K7_BURPS Acyl-CoA dehydrogenase domain protein OS=... 34 6.0
tr|A7V7W5|A7V7W5_BACUN Putative uncharacterized protein OS=Bacte... 34 6.0
tr|A6FM30|A6FM30_9RHOB Acyl-CoA dehydrogenase-like protein OS=Ro... 34 6.0
tr|A4LJ33|A4LJ33_BURPS Acyl-CoA dehydrogenase domain protein OS=... 34 6.0
tr|Q9I460|Q9I460_PSEAE Probable acyl-CoA dehydrogenase OS=Pseudo... 33 7.8
tr|Q02JC5|Q02JC5_PSEAB Putative acyl-CoA dehydrogenase OS=Pseudo... 33 7.8
tr|B2HYK6|B2HYK6_ACIBC Acyl-CoA dehydrogenase OS=Acinetobacter b... 33 7.8
tr|B0VRD7|B0VRD7_ACIBS Acyl-CoA dehydrogenase OS=Acinetobacter b... 33 7.8
tr|B0V535|B0V535_ACIBY Acyl-CoA dehydrogenase OS=Acinetobacter b... 33 7.8
tr|A6V8S5|A6V8S5_PSEA7 Probable acyl-CoA dehydrogenase OS=Pseudo... 33 7.8
tr|A3M8P8|A3M8P8_ACIBT Acyl-CoA dehydrogenase OS=Acinetobacter b... 33 7.8
tr|B7UWG6|B7UWG6_PSEAE Probable acyl-CoA dehydrogenase OS=Pseudo... 33 7.8
tr|B7I8L7|B7I8L7_ACIBA Acyl-CoA dehydrogenase OS=Acinetobacter b... 33 7.8
tr|B7GWN9|B7GWN9_ACIBA Acyl-CoA dehydrogenase, C-terminal domain... 33 7.8
tr|A3LC33|A3LC33_PSEAE Putative uncharacterized protein OS=Pseud... 33 7.8
tr|A3KRL6|A3KRL6_PSEAE Putative uncharacterized protein OS=Pseud... 33 7.8

>tr|Q8L0X1|Q8L0X1_9GAMM Acyl-CoA dehydrogenase B OS=Acinetobacter
sp. M-1 GN=acdB PE=4 SV=1
Length = 599

Score = 39.3 bits (90), Expect = 0.14
Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
Frame = -2

Query: 535 YAISFMSLYIAAGNDDFSEMHGLLSLVRLVAGPKGLRRTGIGSFVLPH*TGKVKHEL-QI 359
YAIS ++I+AG D +E + L RL PKG + GI F++P+ T + +L +
Sbjct: 189 YAISGEKIFISAGEHDMAENIIHIVLARLPGAPKGTK--GISLFIVPNSTSMLMVQLASV 246

Query: 358 LQISMVAFVRRLAI 317
+Q +V F ++ I
Sbjct: 247 MQYVVVQFEHKMGI 260


>tr|A3TT84|A3TT84_9RHOB Acyl-CoA dehydrogenase family protein
OS=Oceanicola batsensis HTCC2597 GN=OB2597_06245 PE=4
SV=1
Length = 592

Score = 35.0 bits (79), Expect = 2.7
Identities = 17/47 (36%), Positives = 30/47 (63%)
Frame = -2

Query: 535 YAISFMSLYIAAGNDDFSEMHGLLSLVRLVAGPKGLRRTGIGSFVLP 395
YAI+ ++I+AG+ D SE L L ++ GP+G++ G+ F++P
Sbjct: 187 YAITGQKIFISAGDHDMSENVIHLVLAKIPGGPEGIK--GVSLFIVP 231


>tr|A3SI50|A3SI50_9RHOB Acyl-CoA dehydrogenase family protein
OS=Roseovarius nubinhibens ISM GN=ISM_02040 PE=4 SV=1
Length = 591

Score = 34.7 bits (78), Expect = 3.5
Identities = 17/47 (36%), Positives = 29/47 (61%)
Frame = -2

Query: 535 YAISFMSLYIAAGNDDFSEMHGLLSLVRLVAGPKGLRRTGIGSFVLP 395
YAIS ++I+AG D +E L L ++ GP+G++ G+ F++P
Sbjct: 187 YAISGQKIFISAGEHDMAENIIHLVLAKIPGGPEGIK--GVSLFIVP 231


>tr|A8LRD4|A8LRD4_DINSH Acyl-CoA dehydrogenase domain protein
OS=Dinoroseobacter shibae (strain DFL 12) GN=Dshi_0839
PE=4 SV=1
Length = 592

Score = 34.3 bits (77), Expect = 4.6
Identities = 18/47 (38%), Positives = 29/47 (61%)
Frame = -2

Query: 535 YAISFMSLYIAAGNDDFSEMHGLLSLVRLVAGPKGLRRTGIGSFVLP 395
YAI+ ++I+AG D SE L L ++ GP+G++ GI F++P
Sbjct: 187 YAITGQKIWISAGEHDMSENIIHLVLAKIPGGPEGVK--GISLFIVP 231


>tr|Q63X89|Q63X89_BURPS Putative acyl-CoA dehydrogenase
oxidoreductase protein OS=Burkholderia pseudomallei
GN=BPSL0648 PE=4 SV=1
Length = 595

Score = 33.9 bits (76), Expect = 6.0
Identities = 19/47 (40%), Positives = 28/47 (59%)
Frame = -2

Query: 535 YAISFMSLYIAAGNDDFSEMHGLLSLVRLVAGPKGLRRTGIGSFVLP 395
Y+IS ++I++G DFS+ L L RL PKG + GI F++P
Sbjct: 190 YSISGTKIFISSGEHDFSKNIVHLVLARLPDAPKGTK--GISLFIVP 234


>tr|Q3JVY3|Q3JVY3_BURP1 Acyl-CoA dehydrogenase domain protein
OS=Burkholderia pseudomallei (strain 1710b)
GN=BURPS1710b_0857 PE=4 SV=1
Length = 595

Score = 33.9 bits (76), Expect = 6.0
Identities = 19/47 (40%), Positives = 28/47 (59%)
Frame = -2

Query: 535 YAISFMSLYIAAGNDDFSEMHGLLSLVRLVAGPKGLRRTGIGSFVLP 395
Y+IS ++I++G DFS+ L L RL PKG + GI F++P
Sbjct: 190 YSISGTKIFISSGEHDFSKNIVHLVLARLPDAPKGTK--GISLFIVP 234


>tr|Q2T128|Q2T128_BURTA Acyl-CoA dehydrogenase domain protein
OS=Burkholderia thailandensis (strain E264 / ATCC 700388
/ DSM 13276 / CIP 106301) GN=BTH_I0564 PE=4 SV=1
Length = 595

Score = 33.9 bits (76), Expect = 6.0
Identities = 19/47 (40%), Positives = 28/47 (59%)
Frame = -2

Query: 535 YAISFMSLYIAAGNDDFSEMHGLLSLVRLVAGPKGLRRTGIGSFVLP 395
Y+IS ++I++G DFS+ L L RL PKG + GI F++P
Sbjct: 190 YSISGTKIFISSGEHDFSKNIVHLVLARLPDAPKGTK--GISLFIVP 234


>tr|A3NRK6|A3NRK6_BURP0 Acyl-CoA dehydrogenase domain protein
OS=Burkholderia pseudomallei (strain 1106a)
GN=BURPS1106A_0695 PE=4 SV=1
Length = 595

Score = 33.9 bits (76), Expect = 6.0
Identities = 19/47 (40%), Positives = 28/47 (59%)
Frame = -2

Query: 535 YAISFMSLYIAAGNDDFSEMHGLLSLVRLVAGPKGLRRTGIGSFVLP 395
Y+IS ++I++G DFS+ L L RL PKG + GI F++P
Sbjct: 190 YSISGTKIFISSGEHDFSKNIVHLVLARLPDAPKGTK--GISLFIVP 234


>tr|A3N5W1|A3N5W1_BURP6 Acyl-CoA dehydrogenase domain protein
OS=Burkholderia pseudomallei (strain 668)
GN=BURPS668_0680 PE=4 SV=1
Length = 595

Score = 33.9 bits (76), Expect = 6.0
Identities = 19/47 (40%), Positives = 28/47 (59%)
Frame = -2

Query: 535 YAISFMSLYIAAGNDDFSEMHGLLSLVRLVAGPKGLRRTGIGSFVLP 395
Y+IS ++I++G DFS+ L L RL PKG + GI F++P
Sbjct: 190 YSISGTKIFISSGEHDFSKNIVHLVLARLPDAPKGTK--GISLFIVP 234


>tr|B7CJ51|B7CJ51_BURPS Acyl-CoA dehydrogenase domain protein
OS=Burkholderia pseudomallei 576 GN=BUC_0905 PE=4 SV=1
Length = 595

Score = 33.9 bits (76), Expect = 6.0
Identities = 19/47 (40%), Positives = 28/47 (59%)
Frame = -2

Query: 535 YAISFMSLYIAAGNDDFSEMHGLLSLVRLVAGPKGLRRTGIGSFVLP 395
Y+IS ++I++G DFS+ L L RL PKG + GI F++P
Sbjct: 190 YSISGTKIFISSGEHDFSKNIVHLVLARLPDAPKGTK--GISLFIVP 234