BP918687
Clone id YMU001_000116_D03
Library
Length 518
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000116_D03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTGTGGAGCTTCGGGAGGTGCATGGCCTTCTCTCTCAGTGTTTTGGGTAGGGTATGCTTC
CATGATTTCTGAGTCGGAGGAGGAATCACTAGCGGCTATTTTAGGGTCTTGGGTGGTGCT
ACCTTGTGTCCCCGCTGAGGGTCTAGAGCTTATCGTGGATGGGTAATGGGTGTCCATATG
AACAGAAGCACCCTCAATATGCTCGTGTTCTAGCACCCGCCCAGAGCGTAAGTGCATGTG
CTTTTGATACCCTAAGGTGTCAAAAAGCTGCTCTAAGAGGCCTTGTGACTAGTTTTTAGC
GTGTTTTTTGTTTGTTTTTTTGCTAGACTTTTTGGATAATTTGGAAATGGCTTTTCTGGT
ATCGGGAAGGGATGACGAAGCTACTAAGTTAAGGGCCTTTCCTTTGGTCTTGAGGGAAGG
TGCAAAATTATGGTATCAAACTTTGGCACCTGAAGAAAGAAGAGACTGGGAGTCCTTAAA
GATGGCCTTCATCGAAGAATTTCGCCGCCATGAGCCTC
■■Homology search results ■■ -
sp_hit_id Q8N5T2
Definition sp|Q8N5T2|TBC19_HUMAN TBC1 domain family member 19 OS=Homo sapiens
Align length 42
Score (bit) 31.2
E-value 2.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918687|Adiantum capillus-veneris mRNA, clone:
YMU001_000116_D03.
(503 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8N5T2|TBC19_HUMAN TBC1 domain family member 19 OS=Homo sapie... 31 2.9
sp|Q06841|NO75_LUPLU Early nodulin-75 (Fragment) OS=Lupinus lute... 30 4.9
sp|Q9TTD8|PROP1_CANFA Homeobox protein prophet of Pit-1 OS=Canis... 30 8.3

>sp|Q8N5T2|TBC19_HUMAN TBC1 domain family member 19 OS=Homo sapiens
GN=TBC1D19 PE=1 SV=1
Length = 526

Score = 31.2 bits (69), Expect = 2.9
Identities = 16/42 (38%), Positives = 20/42 (47%)
Frame = -1

Query: 140 PQRGHKVAPPKTLK*PLVIPPPTQKSWKHTLPKTLREKAMHL 15
P H APP+ LK PLV Q SW+ + K+L L
Sbjct: 75 PLPSHPAAPPEHLKEPLVYMRKAQGSWEKRILKSLNSMCTEL 116


>sp|Q06841|NO75_LUPLU Early nodulin-75 (Fragment) OS=Lupinus luteus
GN=ENOD2 PE=2 SV=1
Length = 434

Score = 30.4 bits (67), Expect = 4.9
Identities = 20/44 (45%), Positives = 23/44 (52%), Gaps = 2/44 (4%)
Frame = -1

Query: 137 QRGHKVAPPKTLK*PLVIPPPTQKSWKHTLPKTLREKA--MHLP 12
+R V PP K P V PPP +KS H P EKA +HLP
Sbjct: 262 ERSPPVHPPSHEKPPFVYPPPHEKSPMHEPP---YEKAPPVHLP 302


>sp|Q9TTD8|PROP1_CANFA Homeobox protein prophet of Pit-1 OS=Canis
familiaris GN=PROP1 PE=3 SV=1
Length = 226

Score = 29.6 bits (65), Expect = 8.3
Identities = 16/39 (41%), Positives = 17/39 (43%)
Frame = -1

Query: 176 WTPITHPR*ALDPQRGHKVAPPKTLK*PLVIPPPTQKSW 60
W P HP P GH PP PL + PP KSW
Sbjct: 194 WYPTLHP-----PPTGHLPCPPPPTMLPLSLEPP--KSW 225


tr_hit_id Q2AA09
Definition tr|Q2AA09|Q2AA09_ASPOF Retrotransposon gag protein OS=Asparagus officinalis
Align length 48
Score (bit) 44.3
E-value 0.003
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918687|Adiantum capillus-veneris mRNA, clone:
YMU001_000116_D03.
(503 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q2AA09|Q2AA09_ASPOF Retrotransposon gag protein OS=Asparagus ... 44 0.003
tr|A5CAW7|A5CAW7_VITVI Putative uncharacterized protein OS=Vitis... 43 0.007
tr|A7R5Q5|A7R5Q5_VITVI Chromosome undetermined scaffold_1022, wh... 43 0.010
tr|A5C692|A5C692_VITVI Putative uncharacterized protein OS=Vitis... 42 0.016
tr|A5AZT3|A5AZT3_VITVI Putative uncharacterized protein OS=Vitis... 42 0.016
tr|A5C960|A5C960_VITVI Putative uncharacterized protein OS=Vitis... 42 0.021
tr|A5C5A7|A5C5A7_VITVI Putative uncharacterized protein OS=Vitis... 42 0.021
tr|A5C2B6|A5C2B6_VITVI Putative uncharacterized protein OS=Vitis... 42 0.021
tr|A5BW74|A5BW74_VITVI Putative uncharacterized protein OS=Vitis... 41 0.028
tr|A5BKN7|A5BKN7_VITVI Putative uncharacterized protein OS=Vitis... 41 0.028
tr|A5BEC4|A5BEC4_VITVI Putative uncharacterized protein OS=Vitis... 41 0.028
tr|A5B7A2|A5B7A2_VITVI Putative uncharacterized protein OS=Vitis... 41 0.028
tr|A5B0D4|A5B0D4_VITVI Putative uncharacterized protein OS=Vitis... 41 0.028
tr|A5ATP5|A5ATP5_VITVI Putative uncharacterized protein OS=Vitis... 41 0.028
tr|Q9SKR9|Q9SKR9_ARATH Putative Athila retroelement ORF1 protein... 41 0.037
tr|A7R230|A7R230_VITVI Chromosome undetermined scaffold_395, who... 41 0.037
tr|A5C991|A5C991_VITVI Putative uncharacterized protein OS=Vitis... 41 0.037
tr|A5C8W0|A5C8W0_VITVI Putative uncharacterized protein OS=Vitis... 41 0.037
tr|A5C6F8|A5C6F8_VITVI Putative uncharacterized protein OS=Vitis... 41 0.037
tr|A5C6D1|A5C6D1_VITVI Putative uncharacterized protein OS=Vitis... 41 0.037
tr|A5BVW3|A5BVW3_VITVI Putative uncharacterized protein OS=Vitis... 41 0.037
tr|A5BFP8|A5BFP8_VITVI Putative uncharacterized protein OS=Vitis... 41 0.037
tr|A5AH69|A5AH69_VITVI Putative uncharacterized protein OS=Vitis... 41 0.037
tr|A5AE33|A5AE33_VITVI Putative uncharacterized protein OS=Vitis... 41 0.037
tr|A7QXC8|A7QXC8_VITVI Chromosome undetermined scaffold_220, who... 40 0.048
tr|A7QXB5|A7QXB5_VITVI Chromosome undetermined scaffold_219, who... 40 0.048
tr|A7QWB8|A7QWB8_VITVI Chromosome chr6 scaffold_202, whole genom... 40 0.048
tr|A7QRX1|A7QRX1_VITVI Chromosome undetermined scaffold_153, who... 40 0.048
tr|A7QD98|A7QD98_VITVI Chromosome undetermined scaffold_80, whol... 40 0.048
tr|A5C950|A5C950_VITVI Putative uncharacterized protein OS=Vitis... 40 0.048

>tr|Q2AA09|Q2AA09_ASPOF Retrotransposon gag protein OS=Asparagus
officinalis GN=20.t00008 PE=4 SV=1
Length = 275

Score = 44.3 bits (103), Expect = 0.003
Identities = 19/48 (39%), Positives = 29/48 (60%)
Frame = +2

Query: 359 VSGRDDEATKLRAFPLVLREGAKLWYQTLAPEERRDWESLKMAFIEEF 502
++G D+A KLR FP LR+ A+ W Q+L P W+ L AF+ ++
Sbjct: 1 MNGVSDDAIKLRLFPFSLRDKARAWLQSLPPGSITTWDQLSEAFLAKY 48


>tr|A5CAW7|A5CAW7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_010015 PE=4 SV=1
Length = 563

Score = 43.1 bits (100), Expect = 0.007
Identities = 17/50 (34%), Positives = 29/50 (58%)
Frame = +2

Query: 353 FLVSGRDDEATKLRAFPLVLREGAKLWYQTLAPEERRDWESLKMAFIEEF 502
FL G + +L+ FP L++ AK+W +L P R W +L++ F++ F
Sbjct: 224 FLEGGASIDLMRLKLFPFTLKDKAKIWLNSLRPRSIRTWTNLQVEFLKNF 273


>tr|A7R5Q5|A7R5Q5_VITVI Chromosome undetermined scaffold_1022, whole
genome shotgun sequence (Fragment) OS=Vitis vinifera
GN=GSVIVT00005333001 PE=4 SV=1
Length = 466

Score = 42.7 bits (99), Expect = 0.010
Identities = 16/42 (38%), Positives = 27/42 (64%)
Frame = +2

Query: 377 EATKLRAFPLVLREGAKLWYQTLAPEERRDWESLKMAFIEEF 502
E +L+ FP L++ AKLW+ +L P+ R W L+ F+++F
Sbjct: 97 ELMRLKLFPFTLKDKAKLWFNSLRPQSIRSWLELQTTFLKKF 138


>tr|A5C692|A5C692_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_026847 PE=4 SV=1
Length = 2036

Score = 42.0 bits (97), Expect = 0.016
Identities = 17/50 (34%), Positives = 28/50 (56%)
Frame = +2

Query: 353 FLVSGRDDEATKLRAFPLVLREGAKLWYQTLAPEERRDWESLKMAFIEEF 502
F G + KL+ FP L++ AK+W +L P R W L++ F+++F
Sbjct: 468 FREGGTSIDLMKLKLFPFTLKDKAKIWLNSLRPRSIRTWTDLQVEFLKKF 517


>tr|A5AZT3|A5AZT3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024057 PE=4 SV=1
Length = 691

Score = 42.0 bits (97), Expect = 0.016
Identities = 17/50 (34%), Positives = 28/50 (56%)
Frame = +2

Query: 353 FLVSGRDDEATKLRAFPLVLREGAKLWYQTLAPEERRDWESLKMAFIEEF 502
F G + +L+ FP L++ AK+W +L P R W L+ AF+++F
Sbjct: 134 FQEGGASIDLMRLKLFPFTLKDKAKIWLNSLRPRSIRTWTDLQAAFLKKF 183


>tr|A5C960|A5C960_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_022527 PE=4 SV=1
Length = 2166

Score = 41.6 bits (96), Expect = 0.021
Identities = 16/50 (32%), Positives = 28/50 (56%)
Frame = +2

Query: 353 FLVSGRDDEATKLRAFPLVLREGAKLWYQTLAPEERRDWESLKMAFIEEF 502
F G + +L+ FP L++ AK+W+ +L P R W L+ F+++F
Sbjct: 20 FQEGGASIDLMRLKLFPFTLKDKAKIWFNSLRPRSIRTWTDLQAEFLKKF 69


>tr|A5C5A7|A5C5A7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_014680 PE=4 SV=1
Length = 1853

Score = 41.6 bits (96), Expect = 0.021
Identities = 17/50 (34%), Positives = 27/50 (54%)
Frame = +2

Query: 353 FLVSGRDDEATKLRAFPLVLREGAKLWYQTLAPEERRDWESLKMAFIEEF 502
F G + KL+ FP L++ AK+W +L P R W L+ F+++F
Sbjct: 110 FQEGGASIDLMKLKLFPFTLKDKAKIWLNSLRPRSIRSWTDLQAEFLKKF 159


>tr|A5C2B6|A5C2B6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_023222 PE=4 SV=1
Length = 865

Score = 41.6 bits (96), Expect = 0.021
Identities = 17/50 (34%), Positives = 28/50 (56%)
Frame = +2

Query: 353 FLVSGRDDEATKLRAFPLVLREGAKLWYQTLAPEERRDWESLKMAFIEEF 502
F G + +L+ FP L+E AK+W +L P R+W L+ F+++F
Sbjct: 131 FREGGASIDLMRLKLFPFTLKEKAKIWLNSLRPRSIRNWVDLQAEFLKKF 180


>tr|A5BW74|A5BW74_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_007703 PE=4 SV=1
Length = 400

Score = 41.2 bits (95), Expect = 0.028
Identities = 18/45 (40%), Positives = 25/45 (55%)
Frame = +2

Query: 368 RDDEATKLRAFPLVLREGAKLWYQTLAPEERRDWESLKMAFIEEF 502
R DEA + FPL L + A+ W+ +L P RR W L FI ++
Sbjct: 164 RLDEAQMIMLFPLSLSDAAQRWFASLDPSRRRTWADLGQEFIRQY 208


>tr|A5BKN7|A5BKN7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_027297 PE=4 SV=1
Length = 2356

Score = 41.2 bits (95), Expect = 0.028
Identities = 16/50 (32%), Positives = 28/50 (56%)
Frame = +2

Query: 353 FLVSGRDDEATKLRAFPLVLREGAKLWYQTLAPEERRDWESLKMAFIEEF 502
F G + +L+ FP L++ AK+W +L P R W L++ F+++F
Sbjct: 110 FQEGGASIDLMRLKLFPFTLKDKAKIWLNSLRPRSIRSWTDLQVEFLKKF 159