BP918709
Clone id YMU001_000116_F02
Library
Length 585
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000116_F02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGCTGCAGCTAAAGTGGTGGACTCTCAACCAAGATGGAGAAAAGCGTGGCTCCTAAAGTA
CCCAGGATTTTTGAAATACTTGGTGGAGGCCCCAAACATCATCAAAGATGACCCCTTATT
TTGCCCAGTCCCTCGTGTCCGCACTTGGGCAAATCATTTCAGACTCATAAAGCGACATCC
AAACTAGTTTCACTACCCTTCTATGCCACCACCCAAGGAAATAGAGAGAATATGTGTCTC
TTATATGTGAAAACCCTGAAGGGCACCATTAAGATTTTCACTGGCTCTCCAGAATTGACA
TGTGTCATGATCAAAAAATCTGTAAAACTTTGTTGGCTTGCATTGAAGTGTTCACGCCTT
CCAAAGCCACGGATTTTACACACCTATCTACTAGCAACATTGTCACTGCAATGAAAACCC
TGAAGGGCACCATTAAGATTTTCACTGGCTCTCCAGAATTGACATGTGTCATGATCAAAA
AATCTGTAAAACTTTGTTGGCTTGCATTGAAGTGTTCACGCCTTCCAAAGCCACGGATTT
TACACACATATCTACTGGCAACATTGTCACTGCAATGACATATGA
■■Homology search results ■■ -
sp_hit_id Q96Q80
Definition sp|Q96Q80|DERL3_HUMAN Derlin-3 OS=Homo sapiens
Align length 69
Score (bit) 31.6
E-value 3.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918709|Adiantum capillus-veneris mRNA, clone:
YMU001_000116_F02.
(585 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q96Q80|DERL3_HUMAN Derlin-3 OS=Homo sapiens GN=DERL3 PE=1 SV=2 32 3.0
sp|A6NKD9|CC85C_HUMAN Coiled-coil domain-containing protein 85C ... 32 3.1
sp|P16230|SRCH_RABIT Sarcoplasmic reticulum histidine-rich calci... 31 3.9
sp|Q5I0L6|CYTIP_RAT Cytohesin-interacting protein OS=Rattus norv... 30 6.7
sp|Q91VY6|CYTIP_MOUSE Cytohesin-interacting protein OS=Mus muscu... 30 6.7
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associat... 30 6.8
sp|O60759|CYTIP_HUMAN Cytohesin-interacting protein OS=Homo sapi... 30 8.8

>sp|Q96Q80|DERL3_HUMAN Derlin-3 OS=Homo sapiens GN=DERL3 PE=1 SV=2
Length = 235

Score = 31.6 bits (70), Expect = 3.0
Identities = 22/69 (31%), Positives = 35/69 (50%)
Frame = +2

Query: 14 VVDSQPRWRKAWLLKYPGFLKYLVEAPNIIKDDPLFCPVPRVRTWANHFRLIKRHPN*FH 193
V +QP ++ LL+ PGFLK L++AP +DP + P+P + P
Sbjct: 188 VFPNQPGGKR--LLQTPGFLKLLLDAP---AEDPNYLPLP------------EEQPG--- 227

Query: 194 YPSMPPPKE 220
P +PPP++
Sbjct: 228 -PHLPPPQQ 235


>sp|A6NKD9|CC85C_HUMAN Coiled-coil domain-containing protein 85C
OS=Homo sapiens GN=CCDC85C PE=3 SV=1
Length = 419

Score = 31.6 bits (70), Expect = 3.1
Identities = 17/70 (24%), Positives = 31/70 (44%), Gaps = 2/70 (2%)
Frame = +1

Query: 82 GGGPKHHQR*P--LILPSPSCPHLGKSFQTHKATSKLVSLPFYATTQGNRENMCLLYVKT 255
GG P HH P L+ P P GK+ T ++ L + P + + + Y++
Sbjct: 214 GGSPDHHHHVPPPLLPPGPHKAPDGKAGATRRSLDDLSAPPHHRSIPNGLHDPSSTYIRQ 273

Query: 256 LKGTIKIFTG 285
L+ +++ G
Sbjct: 274 LESKVRLLEG 283


>sp|P16230|SRCH_RABIT Sarcoplasmic reticulum histidine-rich
calcium-binding protein OS=Oryctolagus cuniculus GN=HRC
PE=1 SV=1
Length = 852

Score = 31.2 bits (69), Expect = 3.9
Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 1/50 (2%)
Frame = +2

Query: 395 QHCHCNENPEGHH*DFHWLSRIDMCHDQKICKTL-LACIEVFTPSKATDF 541
+HCHC+E+ G H D C + C L C V TP D+
Sbjct: 793 EHCHCDEDSMGEH--------CDQCQHCQFCYLCPLVCETVCTPGSYVDY 834


>sp|Q5I0L6|CYTIP_RAT Cytohesin-interacting protein OS=Rattus
norvegicus GN=Cytip PE=2 SV=1
Length = 359

Score = 30.4 bits (67), Expect = 6.7
Identities = 20/67 (29%), Positives = 35/67 (52%)
Frame = +3

Query: 345 EVFTPSKATDFTHLSTSNIVTAMKTLKGTIKIFTGSPELTCVMIKKSVKLCWLALKCSRL 524
E FT + D S+ N++T ++TL GT+ E +K+++K W+ L+ L
Sbjct: 140 EGFTHKQVVDLIR-SSGNLLT-IETLNGTMIHRRAELEAKLQTLKQTLKKKWVELRSLHL 197

Query: 525 PKPRILH 545
+ R+LH
Sbjct: 198 QEQRLLH 204


>sp|Q91VY6|CYTIP_MOUSE Cytohesin-interacting protein OS=Mus musculus
GN=Cytip PE=2 SV=1
Length = 359

Score = 30.4 bits (67), Expect = 6.7
Identities = 20/67 (29%), Positives = 35/67 (52%)
Frame = +3

Query: 345 EVFTPSKATDFTHLSTSNIVTAMKTLKGTIKIFTGSPELTCVMIKKSVKLCWLALKCSRL 524
E FT + D S+ N++T ++TL GT+ E +K+++K W+ L+ L
Sbjct: 140 EGFTHKQVVDLIR-SSGNLLT-IETLNGTMIHRRAELEAKLQTLKQTLKKKWVELRSLHL 197

Query: 525 PKPRILH 545
+ R+LH
Sbjct: 198 QEQRLLH 204


>sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated
protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3
SV=1
Length = 4246

Score = 30.4 bits (67), Expect = 6.8
Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 12/62 (19%)
Frame = +1

Query: 181 KLVSLPFYATTQGNRENM------------CLLYVKTLKGTIKIFTGSPELTCVMIKKSV 324
KL ++ FY +QG + C++ +TL +K+F G P L ++ +KS+
Sbjct: 1280 KLNNIQFYIASQGESLQLVEKFDINFKIYKCIIKSQTLLSKLKLFGGLPSLNMLLSQKSI 1339

Query: 325 KL 330
++
Sbjct: 1340 EI 1341


>sp|O60759|CYTIP_HUMAN Cytohesin-interacting protein OS=Homo sapiens
GN=CYTIP PE=1 SV=2
Length = 359

Score = 30.0 bits (66), Expect = 8.8
Identities = 19/67 (28%), Positives = 37/67 (55%)
Frame = +3

Query: 345 EVFTPSKATDFTHLSTSNIVTAMKTLKGTIKIFTGSPELTCVMIKKSVKLCWLALKCSRL 524
E FT + D S+ N++T ++TL GT+ + E ++K+++K W+ + +L
Sbjct: 140 EGFTYKQVVDLIR-SSGNLLT-IETLNGTMILKRTELEAKLQVLKQTLKQKWVEYRSLQL 197

Query: 525 PKPRILH 545
+ R+LH
Sbjct: 198 QEHRLLH 204


tr_hit_id Q6ZE57
Definition tr|Q6ZE57|Q6ZE57_SYNY3 Sll8035 protein OS=Synechocystis sp. (strain PCC 6803)
Align length 55
Score (bit) 34.7
E-value 4.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918709|Adiantum capillus-veneris mRNA, clone:
YMU001_000116_F02.
(585 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q6ZE57|Q6ZE57_SYNY3 Sll8035 protein OS=Synechocystis sp. (str... 35 4.0
tr|A8GBS1|A8GBS1_SERP5 GCN5-related N-acetyltransferase OS=Serra... 34 6.9
tr|A6VMV3|A6VMV3_ACTSZ DNA polymerase III psi subunit OS=Actinob... 33 9.0

>tr|Q6ZE57|Q6ZE57_SYNY3 Sll8035 protein OS=Synechocystis sp. (strain
PCC 6803) GN=sll8035 PE=4 SV=1
Length = 167

Score = 34.7 bits (78), Expect = 4.0
Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 3/55 (5%)
Frame = -3

Query: 232 YSLYFLGWWHRR--VVKLVWMSLYESEMICPSADTRDWAK*GVIFDDVW-GLHQV 77
+S +LGWW + L+W + Y + + P T +WA GV+ + VW HQV
Sbjct: 41 WSRVWLGWWSLIPIAIALLW-NWYNARLFSPPQSTDNWASKGVLGERVWINRHQV 94


>tr|A8GBS1|A8GBS1_SERP5 GCN5-related N-acetyltransferase OS=Serratia
proteamaculans (strain 568) GN=Spro_1457 PE=4 SV=1
Length = 283

Score = 33.9 bits (76), Expect = 6.9
Identities = 19/55 (34%), Positives = 28/55 (50%)
Frame = -3

Query: 583 ICHCSDNVASRYVCKIRGFGRREHFNASQQSFTDFLIMTHVNSGEPVKILMVPFR 419
+CHC +N R+V F RR F A S D +I+TH +PV + ++ R
Sbjct: 24 LCHCFENYIVRFVIDGATFARR--FGAEDLSLNDSIIVTH--QQQPVALALISRR 74


>tr|A6VMV3|A6VMV3_ACTSZ DNA polymerase III psi subunit
OS=Actinobacillus succinogenes (strain ATCC 55618 /
130Z) GN=Asuc_0932 PE=4 SV=1
Length = 135

Score = 33.5 bits (75), Expect = 9.0
Identities = 16/44 (36%), Positives = 24/44 (54%)
Frame = -3

Query: 571 SDNVASRYVCKIRGFGRREHFNASQQSFTDFLIMTHVNSGEPVK 440
SDN+ R C ++ R N S+ FTDF ++H+N P+K
Sbjct: 42 SDNLPERQNCLLQDILRSVELNQSECLFTDFAHISHLNIRHPLK 85