BP918734
Clone id YMU001_000116_H05
Library
Length 594
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000116_H05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AACTAGAAGAATTCGCGGTCGCAGGAATTTTCGTTGATTCGGCACTTTTTTTGGAGAAAA
GATACCACCCTCTCCCTTTTAAAGTTGGTATATTCTCACATGTAATCTCACTATATCATT
CAGAAAGTATCTCTTGGGATTCACTGTTTATTAGCTTTTTCTTTTTAGACATACTCGTGA
TATTCTCTACACACTTCCTCAAAATCTATTTTCTCACCCTCAAATTTAAAATTTAGAGGT
AAATCTCAAAATTTGTATGTGGGATCACTACGTTATTTTGAGCACTTACTGTAAATGAAA
CATCTCATACCTTGCATCCTAAAATTTAGAGTCTTCAAAATTTAGGTCCAATAAAGCATT
TTAGTGTTTTCAAACGGTCTAGACCTCCATTAGCCCATCTTGTCTAAGCGTAGCTACATC
TGACAATGATTAAGCACATTACCATTTAAGGACCACAGTGTTTCCACAAGCTTTTCTAGA
TGAAGCTGCTCGTGCAAATATGACAATGGCCATGCTTCAGAGTGTTAAGTACAATGCCTA
CCTTAAGTGTAAAGACAACCAATGGCCTCGGTATGCAAGATCTAGCCGAGATAT
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918734|Adiantum capillus-veneris mRNA, clone:
YMU001_000116_H05.
(563 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id O31811
Definition tr|O31811|O31811_BACSU YndG protein OS=Bacillus subtilis
Align length 89
Score (bit) 34.7
E-value 3.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918734|Adiantum capillus-veneris mRNA, clone:
YMU001_000116_H05.
(563 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|O31811|O31811_BACSU YndG protein OS=Bacillus subtilis GN=yndG... 35 3.7

>tr|O31811|O31811_BACSU YndG protein OS=Bacillus subtilis GN=yndG
PE=4 SV=1
Length = 268

Score = 34.7 bits (78), Expect = 3.7
Identities = 24/89 (26%), Positives = 40/89 (44%)
Frame = -2

Query: 466 LHEQLHLEKLVETLWSLNGNVLNHCQM*LRLDKMG*WRSRPFENTKMLYWT*ILKTLNFR 287
++ ++ ++ ++TLW N H + LR + S+P E K LY T + L
Sbjct: 6 IYVEIEMKSDLDTLWEYTQNPSLHKEWDLRFSNITYLNSQPCEKQKFLYETRVGFGLKVS 65

Query: 286 MQGMRCFIYSKCSK*RSDPTYKF*DLPLN 200
G +++KCS RS D PL+
Sbjct: 66 GTGETVGVFNKCSSERSSSLAFGSDHPLS 94