BP918746
Clone id YMU001_000117_A07
Library
Length 409
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000117_A07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAAGCCCTCGTACCATACCTTTGCTTTTCCACGAATCAGGGCCACTCCCTCTTCTCTTGA
CAAGCCGCTTTCCAGCACAAATAGCCCATAGTCCTGCAACCACACTTCTGCATCTTCAAC
AGCTGTAAAAGTCGGAAAACCCGATCACATCTTGCTTAGCAGCACTTGCTATTTAACACT
GGTATCACCACAACACTGTCTTCAACTTTATCGAGAAGCTATCAGTAGCTCCTCAGTGGG
GGCACCACAAGATGGAAAGGGGGAAACGAGAGAACCATCAACACACAATCTGAATGCCTC
TATATAGCCCAGTGATTTCACAGCACCCCAATCCCCTATTTAACACATATCTCGATACAC
AATCTGCAACCTACTATTGTCCAAGCCCAAATCCAAACAACCCTAACTG
■■Homology search results ■■ -
sp_hit_id A2A884
Definition sp|A2A884|ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus
Align length 91
Score (bit) 30.8
E-value 2.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918746|Adiantum capillus-veneris mRNA, clone:
YMU001_000117_A07.
(409 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A2A884|ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus... 31 2.2
sp|A4SUZ2|ENGB_POLSQ Probable GTP-binding protein engB OS=Polynu... 30 3.8
sp|P09279|VP26_VZVD Capsid protein VP26 OS=Varicella-zoster viru... 30 5.0
sp|Q9P2N2|RHG28_HUMAN Rho GTPase-activating protein 28 OS=Homo s... 30 5.0
sp|Q9UJV8|PURG_HUMAN Purine-rich element-binding protein gamma O... 29 6.3
sp|Q0VFP6|CXXC4_XENTR CXXC-type zinc finger protein 4 OS=Xenopus... 29 6.5
sp|Q800L6|CXXC4_XENLA CXXC-type zinc finger protein 4 OS=Xenopus... 29 6.5
sp|Q54GU5|Y6504_DICDI Uncharacterized protein DDB_G0289917 OS=Di... 29 8.5
sp|Q15QB4|OSTA_PSEA6 LPS-assembly protein OS=Pseudoalteromonas a... 29 8.5
sp|Q6XV24|NRAM_I84A4 Neuraminidase OS=Influenza A virus (strain ... 29 8.5
sp|Q6XV28|NRAM_I77AG Neuraminidase OS=Influenza A virus (strain ... 29 8.5
sp|Q6XV23|NRAM_I77AF Neuraminidase OS=Influenza A virus (strain ... 29 8.5
sp|Q6XV26|NRAM_I76AK Neuraminidase OS=Influenza A virus (strain ... 29 8.5
sp|Q6XV27|NRAM_I56A2 Neuraminidase OS=Influenza A virus (strain ... 29 8.5
sp|P98088|MUC5A_HUMAN Mucin-5AC (Fragments) OS=Homo sapiens GN=M... 29 8.5
sp|Q9MZV8|MC5R_PIG Melanocortin receptor 5 (Fragment) OS=Sus scr... 29 8.5
sp|Q9EQC9|CXXC4_RAT CXXC-type zinc finger protein 4 OS=Rattus no... 29 8.5
sp|Q6NXI8|CXXC4_MOUSE CXXC-type zinc finger protein 4 OS=Mus mus... 29 8.5
sp|Q9H2H0|CXXC4_HUMAN CXXC-type zinc finger protein 4 OS=Homo sa... 29 8.5

>sp|A2A884|ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus
GN=Hivep3 PE=1 SV=1
Length = 2348

Score = 30.8 bits (68), Expect = 2.2
Identities = 25/91 (27%), Positives = 35/91 (38%)
Frame = +2

Query: 5 PSYHTFAFPRIRATPSSLDKPLSSTNSP*SCNHTSASSTAVKVGKPDHILLSSTCYLTLV 184
PS T PR+ P L+K +SS SP + + S + + G + +
Sbjct: 1898 PSRGTQGLPRLGLAP--LEKDMSSAPSPKATSPRRPWSPSKEAGSRPSLTRKHSLTKNDS 1955

Query: 185 SPQHCLQLYREAISSSSVGAPQDGKGETREP 277
SPQ C S +S PQ G G P
Sbjct: 1956 SPQQCSPAREAQASVTSTPGPQMGPGRDLGP 1986


>sp|A4SUZ2|ENGB_POLSQ Probable GTP-binding protein engB
OS=Polynucleobacter sp. (strain QLW-P1DMWA-1) GN=engB
PE=3 SV=1
Length = 221

Score = 30.0 bits (66), Expect = 3.8
Identities = 18/50 (36%), Positives = 25/50 (50%)
Frame = +2

Query: 125 VKVGKPDHILLSSTCYLTLVSPQHCLQLYREAISSSSVGAPQDGKGETRE 274
V GKP HILLS L +H L+ R+ + P DG GE+++
Sbjct: 136 VPTGKPIHILLSKCDKLNKSECKHALEDVRKQLQQYDPALP-DGTGESQQ 184


>sp|P09279|VP26_VZVD Capsid protein VP26 OS=Varicella-zoster virus
(strain Dumas) GN=23 PE=3 SV=1
Length = 235

Score = 29.6 bits (65), Expect = 5.0
Identities = 27/99 (27%), Positives = 41/99 (41%), Gaps = 12/99 (12%)
Frame = +2

Query: 41 ATPSSLDKPLSSTNSP*SCNHTSASSTAVKVGKPDHILL------------SSTCYLTLV 184
A S+L +P + S S H +T+ VG+ H++ SST T
Sbjct: 133 ADQSALQQPAALAFSGSSPQHPPPQTTSASVGQQQHVVSGSSGQQPQQGAQSSTVQPTTG 192

Query: 185 SPQHCLQLYREAISSSSVGAPQDGKGETREPSTHNLNAS 301
SP Q ++ + PQ GKG+T + + NAS
Sbjct: 193 SPP-AAQGVPQSTPPPTQNTPQGGKGQTLSHTGQSGNAS 230


>sp|Q9P2N2|RHG28_HUMAN Rho GTPase-activating protein 28 OS=Homo
sapiens GN=ARHGAP28 PE=2 SV=2
Length = 729

Score = 29.6 bits (65), Expect = 5.0
Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 3/34 (8%)
Frame = -2

Query: 126 TAVEDAEV---WLQDYGLFVLESGLSREEGVALI 34
T V++ E+ WLQD GL L SG E+G AL+
Sbjct: 105 TPVDEGELEAEWLQDVGLSTLISGDEEEDGKALL 138


>sp|Q9UJV8|PURG_HUMAN Purine-rich element-binding protein gamma
OS=Homo sapiens GN=PURG PE=2 SV=1
Length = 347

Score = 29.3 bits (64), Expect = 6.3
Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 6/64 (9%)
Frame = +3

Query: 204 NFIEKLSVAPQWGH-----HKMERGKRENHQHTI*MPLYSPVISQHPNPLFNT-YLDTQS 365
+FIE + GH H E+G R +H+ P S +HP+ + T Y++ +
Sbjct: 121 DFIEHYAHLGLKGHRQEHGHSKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDN 180

Query: 366 ATYY 377
YY
Sbjct: 181 RKYY 184


>sp|Q0VFP6|CXXC4_XENTR CXXC-type zinc finger protein 4 OS=Xenopus
tropicalis GN=cxxc4 PE=2 SV=2
Length = 188

Score = 29.3 bits (64), Expect = 6.5
Identities = 11/39 (28%), Positives = 23/39 (58%)
Frame = +2

Query: 134 GKPDHILLSSTCYLTLVSPQHCLQLYREAISSSSVGAPQ 250
G P+ + +++ +L+ +SP+HC L E ++ GA +
Sbjct: 14 GAPESLQMANNNFLSTLSPEHCRPLAGECMNKLKCGAAE 52


>sp|Q800L6|CXXC4_XENLA CXXC-type zinc finger protein 4 OS=Xenopus
laevis GN=cxxc4 PE=2 SV=1
Length = 217

Score = 29.3 bits (64), Expect = 6.5
Identities = 11/39 (28%), Positives = 23/39 (58%)
Frame = +2

Query: 134 GKPDHILLSSTCYLTLVSPQHCLQLYREAISSSSVGAPQ 250
G P+ + +++ +L+ +SP+HC L E ++ GA +
Sbjct: 14 GAPESLQMANNNFLSTLSPEHCRPLAGECMNKLKCGAAE 52


>sp|Q54GU5|Y6504_DICDI Uncharacterized protein DDB_G0289917
OS=Dictyostelium discoideum GN=DDB_G0289917 PE=4 SV=1
Length = 968

Score = 28.9 bits (63), Expect = 8.5
Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 7/60 (11%)
Frame = +2

Query: 38 RATPSSLDKPLSSTNSP*SCN-------HTSASSTAVKVGKPDHILLSSTCYLTLVSPQH 196
+A+ S P +S+ +P + +S S+ +K GKP + L + TLV PQH
Sbjct: 837 KASKDSSSSPTASSAAPGDSSSDGEGDEQSSTSTKKMKKGKPLEVTLKHSSGFTLVIPQH 896


>sp|Q15QB4|OSTA_PSEA6 LPS-assembly protein OS=Pseudoalteromonas
atlantica (strain T6c / BAA-1087) GN=imp PE=3 SV=2
Length = 759

Score = 28.9 bits (63), Expect = 8.5
Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%)
Frame = +2

Query: 62 KPLSSTNSP*SCNHTSASSTA--VKVGKPDHILLSSTCYLTLVSPQHC 199
KPL +P NH A+ +K+ +P H+L S C L+ V+ + C
Sbjct: 2 KPLKLELNPRDFNHYQAAFLPYRMKIKQPLHVLCFSVCSLSAVAQETC 49


>sp|Q6XV24|NRAM_I84A4 Neuraminidase OS=Influenza A virus (strain
A/Gull/Astrakhan/227/1984 H13N6) GN=NA PE=3 SV=1
Length = 470

Score = 28.9 bits (63), Expect = 8.5
Identities = 17/49 (34%), Positives = 26/49 (53%)
Frame = +2

Query: 53 SLDKPLSSTNSP*SCNHTSASSTAVKVGKPDHILLSSTCYLTLVSPQHC 199
+L KPL NS H + A+++G+ HIL++ YL+ PQ C
Sbjct: 86 NLTKPLCEVNSW----HILSKDNAIRIGEDAHILVTREPYLS-CDPQGC 129


tr_hit_id Q754S5
Definition tr|Q754S5|Q754S5_ASHGO AFL004Cp OS=Ashbya gossypii
Align length 96
Score (bit) 37.7
E-value 0.29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918746|Adiantum capillus-veneris mRNA, clone:
YMU001_000117_A07.
(409 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q754S5|Q754S5_ASHGO AFL004Cp OS=Ashbya gossypii GN=AFL004C PE... 38 0.29
tr|Q8YP22|Q8YP22_ANASP Delta-aminolevulinic acid dehydratase OS=... 36 1.1
tr|B2J575|B2J575_NOSP7 Delta-aminolevulinic acid dehydratase OS=... 35 2.5
tr|B4PUX2|B4PUX2_DROYA GE24144 OS=Drosophila yakuba GN=GE24144 P... 35 2.5
tr|B2AN06|B2AN06_PODAN Predicted CDS Pa_6_8580 OS=Podospora anse... 34 3.2
tr|Q4WGR5|Q4WGR5_ASPFU C2H2 finger domain protein, putative OS=A... 33 5.5
tr|B0YB47|B0YB47_ASPFC C2H2 finger domain protein, putative OS=A... 33 5.5
tr|A2FJ71|A2FJ71_TRIVA Leucine Rich Repeat family protein OS=Tri... 33 5.5
tr|Q3M7Y1|Q3M7Y1_ANAVT Delta-aminolevulinic acid dehydratase OS=... 33 7.1
tr|B6KJG7|B6KJG7_TOXGO PHD-finger domain-containing protein OS=T... 33 7.1

>tr|Q754S5|Q754S5_ASHGO AFL004Cp OS=Ashbya gossypii GN=AFL004C PE=4
SV=1
Length = 542

Score = 37.7 bits (86), Expect = 0.29
Identities = 26/96 (27%), Positives = 47/96 (48%)
Frame = +2

Query: 38 RATPSSLDKPLSSTNSP*SCNHTSASSTAVKVGKPDHILLSSTCYLTLVSPQHCLQLYRE 217
+ + +++ KP+ ST++P +HT+++ ++ G+ + S+ Y +L +P Y
Sbjct: 247 KTSENAVSKPVKSTHAPKKLSHTASALISLLDGEGKADISESSAYASLSNP------YSS 300

Query: 218 AISSSSVGAPQDGKGETREPSTHNLNASI*PSDFTA 325
IS G P +T EPST +N P TA
Sbjct: 301 HISHMHRGRPSSA-AKTIEPSTKPVNTETTPITSTA 335


>tr|Q8YP22|Q8YP22_ANASP Delta-aminolevulinic acid dehydratase
OS=Anabaena sp. (strain PCC 7120) GN=alr4380 PE=3 SV=1
Length = 326

Score = 35.8 bits (81), Expect = 1.1
Identities = 19/62 (30%), Positives = 26/62 (41%)
Frame = +2

Query: 14 HTFAFPRIRATPSSLDKPLSSTNSP*SCNHTSASSTAVKVGKPDHILLSSTCYLTLVSPQ 193
H P I DK +T + C ++TAVK PD I+++ TC S
Sbjct: 68 HDLGIPAIILFGIPADKDTDATGAWHDCGIVQKAATAVKAAVPDLIVIADTCLCEYTSHG 127

Query: 194 HC 199
HC
Sbjct: 128 HC 129


>tr|B2J575|B2J575_NOSP7 Delta-aminolevulinic acid dehydratase
OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
GN=Npun_F3848 PE=4 SV=1
Length = 326

Score = 34.7 bits (78), Expect = 2.5
Identities = 16/47 (34%), Positives = 24/47 (51%)
Frame = +2

Query: 59 DKPLSSTNSP*SCNHTSASSTAVKVGKPDHILLSSTCYLTLVSPQHC 199
DK + +T + C ++TAVK PD I+++ TC S HC
Sbjct: 83 DKDVDATGAWHDCGIVQKAATAVKAAVPDLIVIADTCLCEYTSHGHC 129


>tr|B4PUX2|B4PUX2_DROYA GE24144 OS=Drosophila yakuba GN=GE24144 PE=4
SV=1
Length = 791

Score = 34.7 bits (78), Expect = 2.5
Identities = 33/114 (28%), Positives = 49/114 (42%)
Frame = +2

Query: 59 DKPLSSTNSP*SCNHTSASSTAVKVGKPDHILLSSTCYLTLVSPQHCLQLYREAISSSSV 238
DKPLSS NS S HT+ASS + L+S H L+ +++ S S+
Sbjct: 244 DKPLSSLNSCSSSGHTNASSEKL-----------------LLSGVHPLESTTDSLDSPSM 286

Query: 239 GAPQDGKGETREPSTHNLNASI*PSDFTAPQSPI*HISRYTICNLLLSKPKSKQ 400
P ++P+ + SD T P +P S+ LL+ P S+Q
Sbjct: 287 YTP------VKQPADSSYQIPTVESDLTTPNTP----SQPNQTISLLTPPSSEQ 330


>tr|B2AN06|B2AN06_PODAN Predicted CDS Pa_6_8580 OS=Podospora
anserina PE=4 SV=1
Length = 480

Score = 34.3 bits (77), Expect = 3.2
Identities = 21/81 (25%), Positives = 34/81 (41%)
Frame = +2

Query: 68 LSSTNSP*SCNHTSASSTAVKVGKPDHILLSSTCYLTLVSPQHCLQLYREAISSSSVGAP 247
+SS P S H+S+ A++ P I+ P HC +LY +S P
Sbjct: 29 MSSEFDPHSLQHSSSEEEAIEKWNPRPIVSD---------PSHCAELYNLLLSRYIAAIP 79

Query: 248 QDGKGETREPSTHNLNASI*P 310
+ +T P+T L ++ P
Sbjct: 80 SEFHSQTHPPTTTALETTLFP 100


>tr|Q4WGR5|Q4WGR5_ASPFU C2H2 finger domain protein, putative
OS=Aspergillus fumigatus GN=AFUA_7G05960 PE=4 SV=1
Length = 1044

Score = 33.5 bits (75), Expect = 5.5
Identities = 29/103 (28%), Positives = 43/103 (41%)
Frame = +2

Query: 29 PRIRATPSSLDKPLSSTNSP*SCNHTSASSTAVKVGKPDHILLSSTCYLTLVSPQHCLQL 208
P + AT L S+T P T +A G HI +SS+ ++L P +
Sbjct: 154 PILPATTVDLTSARSATTFPEGGVETLTPQSAN--GSSKHISVSSSTSMSLGRPLN---- 207

Query: 209 YREAISSSSVGAPQDGKGETREPSTHNLNASI*PSDFTAPQSP 337
Y+ I+ VG P + S H++N+ P AP SP
Sbjct: 208 YQPLIAQHGVGTPDSTTSRSNSLSNHSINSP--PGQANAPFSP 248


>tr|B0YB47|B0YB47_ASPFC C2H2 finger domain protein, putative
OS=Aspergillus fumigatus (strain CEA10 / CBS 144.89 /
FGSC A1163) GN=AFUB_091540 PE=4 SV=1
Length = 1044

Score = 33.5 bits (75), Expect = 5.5
Identities = 29/103 (28%), Positives = 43/103 (41%)
Frame = +2

Query: 29 PRIRATPSSLDKPLSSTNSP*SCNHTSASSTAVKVGKPDHILLSSTCYLTLVSPQHCLQL 208
P + AT L S+T P T +A G HI +SS+ ++L P +
Sbjct: 154 PILPATTVDLTSARSATTFPEGGVETLTPQSAN--GSSKHISVSSSTSMSLGRPLN---- 207

Query: 209 YREAISSSSVGAPQDGKGETREPSTHNLNASI*PSDFTAPQSP 337
Y+ I+ VG P + S H++N+ P AP SP
Sbjct: 208 YQPLIAQHGVGTPDSTTSRSNSLSNHSINSP--PGQANAPFSP 248


>tr|A2FJ71|A2FJ71_TRIVA Leucine Rich Repeat family protein
OS=Trichomonas vaginalis G3 GN=TVAG_034610 PE=4 SV=1
Length = 629

Score = 33.5 bits (75), Expect = 5.5
Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 6/80 (7%)
Frame = +3

Query: 39 GPLPLLLTSRFPAQIAHSPATTLLHLQQL*KSENPITSCLAALAI*HWYHHN------TV 200
GP P + P ++ P + + + +S + I+ C+ LAI W N
Sbjct: 271 GPWPPIPNDILPQEL---PKSCFGVIDNISRSSSYISGCIFGLAIGDWLSWNFERYDKLY 327

Query: 201 FNFIEKLSVAPQWGHHKMER 260
NFI + SV P W H +M R
Sbjct: 328 LNFILEESVNPTWSHIRMTR 347


>tr|Q3M7Y1|Q3M7Y1_ANAVT Delta-aminolevulinic acid dehydratase
OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937)
GN=Ava_3297 PE=3 SV=1
Length = 325

Score = 33.1 bits (74), Expect = 7.1
Identities = 16/47 (34%), Positives = 23/47 (48%)
Frame = +2

Query: 59 DKPLSSTNSP*SCNHTSASSTAVKVGKPDHILLSSTCYLTLVSPQHC 199
DK +T + C ++TAVK PD I+++ TC S HC
Sbjct: 83 DKDTDATGAWHDCGIVQKAATAVKSAVPDLIVIADTCLCEYTSHGHC 129


>tr|B6KJG7|B6KJG7_TOXGO PHD-finger domain-containing protein
OS=Toxoplasma gondii ME49 GN=TGME49_030890 PE=4 SV=1
Length = 743

Score = 33.1 bits (74), Expect = 7.1
Identities = 28/98 (28%), Positives = 48/98 (48%)
Frame = +2

Query: 41 ATPSSLDKPLSSTNSP*SCNHTSASSTAVKVGKPDHILLSSTCYLTLVSPQHCLQLYREA 220
++PSS P SS++S S + S+SS + + SS +L S L +
Sbjct: 346 SSPSSSSSPSSSSSSLSSSSSLSSSSFSSSSLSSSSLSSSSLSSSSLSSSS----LSSSS 401

Query: 221 ISSSSVGAPQDGKGETREPSTHNLNASI*PSDFTAPQS 334
+SSSS+ + + S+ +L++S PS ++PQS
Sbjct: 402 LSSSSLSSSSLSSASSSSLSSSSLSSSFHPSSCSSPQS 439