BP918754
Clone id YMU001_000117_B03
Library
Length 435
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000117_B03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATTGTACAACTTCATGTAGAAACTGATTTCCCTTGCATACGCAGCATTTTCTTGTACCAA
CCTTGCTTTCTCTGCAAGAAGGGCCTCAAGCTGAAGACGGAGCAGATCATCTTCTTCATG
CTTTTCGCCCTTGTCAATATTTTCCCGAAGCCTTTTATGCTCCTCTTCAAGCTGTGTACA
ACGAGCCTTTGTGAATGCGAGATCTGTTATCGCACCTTTTGATTCTCGTAGTAGCAGCTT
TGCTATTGTTGCCATTGCCATGGATACATCTCGAGATGCCTTTAACTGAGTATCTTTCGT
CACTCCCTGCTTTTCTTCTGCCTTGATTTGGGATATTAGGACTTTTTCTTCTGACTTGAC
TTGGGACCTTAGAGCCTTTTCTTCCGACTTGACTTGAGATCTTGAAAGCTTTTCTTCTGA
GTTCGTATGATGCTT
■■Homology search results ■■ -
sp_hit_id A8FJU1
Definition sp|A8FJU1|IF2_CAMJ8 Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Align length 69
Score (bit) 37.7
E-value 0.021
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918754|Adiantum capillus-veneris mRNA, clone:
YMU001_000117_B03.
(435 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A8FJU1|IF2_CAMJ8 Translation initiation factor IF-2 OS=Campyl... 38 0.021
sp|Q8PUY4|RAD50_METMA DNA double-strand break repair rad50 ATPas... 36 0.061
sp|Q5HX30|IF2_CAMJR Translation initiation factor IF-2 OS=Campyl... 36 0.080
sp|A1VXL9|IF2_CAMJJ Translation initiation factor IF-2 OS=Campyl... 36 0.080
sp|Q9PIZ1|IF2_CAMJE Translation initiation factor IF-2 OS=Campyl... 36 0.080
sp|Q7S304|BRE1_NEUCR E3 ubiquitin-protein ligase bre-1 OS=Neuros... 35 0.10
sp|A5UJM9|IF2P_METS3 Probable translation initiation factor IF-2... 35 0.18
sp|Q02040|SF17A_HUMAN Splicing factor, arginine/serine-rich 17A ... 34 0.30
sp|Q74IC0|SYT_LACJO Threonyl-tRNA synthetase OS=Lactobacillus jo... 33 0.40
sp|Q0UJJ7|NST1_PHANO Stress response protein NST1 OS=Phaeosphaer... 33 0.40
sp|Q23495|HEAT1_CAEEL HEAT repeat-containing protein 1 homolog O... 33 0.68
sp|Q98R67|GRPE_MYCPU Protein grpE OS=Mycoplasma pulmonis GN=grpE... 33 0.68
sp|Q09857|YAF3_SCHPO Uncharacterized protein C29E6.03c OS=Schizo... 32 0.89
sp|P35579|MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 32 1.2
sp|Q258K2|MYH9_CANFA Myosin-9 OS=Canis familiaris GN=MYH9 PE=2 SV=1 32 1.2
sp|Q98RF9|Y050_MYCPU UPF0133 protein MYPU_0500 OS=Mycoplasma pul... 32 1.5
sp|Q15149|PLEC1_HUMAN Plectin-1 OS=Homo sapiens GN=PLEC1 PE=1 SV=3 32 1.5
sp|P05453|ERF3_YEAST Eukaryotic peptide chain release factor GTP... 32 1.5
sp|Q8BI22|CN145_MOUSE Uncharacterized protein C14orf145 homolog ... 32 1.5
sp|O55156|CLIP2_RAT CAP-Gly domain-containing linker protein 2 O... 32 1.5
sp|Q9Z0H8|CLIP2_MOUSE CAP-Gly domain-containing linker protein 2... 32 1.5
sp|Q91ZU8|BPAEA_MOUSE Bullous pemphigoid antigen 1, isoform 5 OS... 31 2.0
sp|Q9V2G3|RFCL_PYRAB Replication factor C large subunit OS=Pyroc... 31 2.6
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=... 31 2.6
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dic... 31 2.6
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapie... 31 2.6
sp|Q6CFR0|ATG11_YARLI Autophagy-related protein 11 OS=Yarrowia l... 31 2.6
sp|P13105|TPM1_RANTE Tropomyosin alpha-1 chain OS=Rana temporari... 30 3.4
sp|P58773|TPM1_COTJA Tropomyosin alpha-1 chain OS=Coturnix cotur... 30 3.4
sp|P04268|TPM1_CHICK Tropomyosin alpha-1 chain OS=Gallus gallus ... 30 3.4

>sp|A8FJU1|IF2_CAMJ8 Translation initiation factor IF-2
OS=Campylobacter jejuni subsp. jejuni serotype O:6
(strain 81116 / NCTC 11828) GN=infB PE=3 SV=1
Length = 871

Score = 37.7 bits (86), Expect = 0.021
Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 3/69 (4%)
Frame = -1

Query: 435 KHHTNSEEKLSRSQVKS--EEKALRSQVKSEE-KVLISQIKAEEKQGVTKDTQLKASRDV 265
K + +EKL+ S+ K +E+ L+ +VK EE KV +K EEKQ + + A +
Sbjct: 73 KENIKEQEKLNESEKKEPKKEEKLKQEVKKEELKVEKENVKEEEKQEI-----IDAHKPQ 127

Query: 264 SMAMATIAK 238
S+A AT+AK
Sbjct: 128 SLASATLAK 136


>sp|Q8PUY4|RAD50_METMA DNA double-strand break repair rad50 ATPase
OS=Methanosarcina mazei GN=rad50 PE=3 SV=1
Length = 1070

Score = 36.2 bits (82), Expect = 0.061
Identities = 35/99 (35%), Positives = 48/99 (48%), Gaps = 3/99 (3%)
Frame = -1

Query: 414 EKLSRSQVKSEEKALRSQVKSEEKVLISQIKAEEKQGVTKDTQLKASRDVSMAMATIAKL 235
E L Q KSE A R +V S K L +K EE T ++A R++ ++
Sbjct: 315 EALLLQQEKSESSA-REKVNSGSKELALLLKEEE-------TGVQALRELEKDKVETERV 366

Query: 234 LL--RESKGAIT-DLAFTKARCTQLEEEHKRLRENIDKG 127
L+ R S GA ++ +A QLEEE+KRLRE G
Sbjct: 367 LVECRTSIGAANKEIEGYRANIKQLEEENKRLREKAGFG 405


>sp|Q5HX30|IF2_CAMJR Translation initiation factor IF-2
OS=Campylobacter jejuni (strain RM1221) GN=infB PE=3
SV=1
Length = 871

Score = 35.8 bits (81), Expect = 0.080
Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
Frame = -1

Query: 435 KHHTNSEEKLSRSQVKS--EEKALRSQVKSEE-KVLISQIKAEEKQGVTKDTQLKASRDV 265
K + +EKL+ S+ K +E+ L+ +VK EE K+ K EEKQ + + A +
Sbjct: 73 KENIKEQEKLNESEKKEPKKEEKLKQEVKKEELKIEKENAKEEEKQEI-----IDAHKPQ 127

Query: 264 SMAMATIAK 238
S+A AT+AK
Sbjct: 128 SLASATLAK 136


>sp|A1VXL9|IF2_CAMJJ Translation initiation factor IF-2
OS=Campylobacter jejuni subsp. jejuni serotype O:23/36
(strain 81-176) GN=infB PE=3 SV=1
Length = 871

Score = 35.8 bits (81), Expect = 0.080
Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
Frame = -1

Query: 435 KHHTNSEEKLSRSQVKS--EEKALRSQVKSEE-KVLISQIKAEEKQGVTKDTQLKASRDV 265
K + +EKL+ S+ K +E+ L+ +VK EE K+ K EEKQ + + A +
Sbjct: 73 KENIKEQEKLNESEKKEPKKEEKLKQEVKKEELKIEKENAKEEEKQEI-----IDAHKPQ 127

Query: 264 SMAMATIAK 238
S+A AT+AK
Sbjct: 128 SLASATLAK 136


>sp|Q9PIZ1|IF2_CAMJE Translation initiation factor IF-2
OS=Campylobacter jejuni GN=infB PE=3 SV=1
Length = 871

Score = 35.8 bits (81), Expect = 0.080
Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
Frame = -1

Query: 435 KHHTNSEEKLSRSQVKS--EEKALRSQVKSEE-KVLISQIKAEEKQGVTKDTQLKASRDV 265
K + +EKL+ S+ K +E+ L+ +VK EE K+ K EEKQ + + A +
Sbjct: 73 KENIKEQEKLNESEKKEPKKEEKLKQEVKKEELKIEKENAKEEEKQEI-----IDAHKPQ 127

Query: 264 SMAMATIAK 238
S+A AT+AK
Sbjct: 128 SLASATLAK 136


>sp|Q7S304|BRE1_NEUCR E3 ubiquitin-protein ligase bre-1
OS=Neurospora crassa GN=bre-1 PE=3 SV=1
Length = 707

Score = 35.4 bits (80), Expect = 0.10
Identities = 27/102 (26%), Positives = 51/102 (50%), Gaps = 5/102 (4%)
Frame = -1

Query: 423 NSEEKLSRSQVKSEEKALRSQVKSEEKVLISQIKAEEKQGVTKDTQLKASRDVSMAMATI 244
N + + ++++E + R+ ++ E + L S ++ + +Q T+++++RD +A +
Sbjct: 327 NKQFREDAEKLRAERTSYRATLEQEAQALTSDLEDQIQQKDQDLTRIRSARDELLAELAM 386

Query: 243 AKLLLRESKGAITDL-----AFTKARCTQLEEEHKRLRENID 133
K + K A L A T R TQLE E +RLR D
Sbjct: 387 RKASQEQEKTASAHLNELVEAMTD-RVTQLESELERLRPTED 427


>sp|A5UJM9|IF2P_METS3 Probable translation initiation factor IF-2
OS=Methanobrevibacter smithii (strain PS / ATCC 35061 /
DSM 861) GN=infB PE=3 SV=1
Length = 596

Score = 34.7 bits (78), Expect = 0.18
Identities = 26/74 (35%), Positives = 40/74 (54%)
Frame = -1

Query: 429 HTNSEEKLSRSQVKSEEKALRSQVKSEEKVLISQIKAEEKQGVTKDTQLKASRDVSMAMA 250
H NSEE L+ S+VK + Q+ E + + Q K E+K+ D +K ++ VS
Sbjct: 415 HPNSEEDLNNSEVKLFSGDVIYQILEEYEEWVKQ-KQEDKKKSFYDAIIKPAKFVS---- 469

Query: 249 TIAKLLLRESKGAI 208
+ KL+ R+SK AI
Sbjct: 470 -LPKLVFRQSKPAI 482


>sp|Q02040|SF17A_HUMAN Splicing factor, arginine/serine-rich 17A
OS=Homo sapiens GN=SFRS17A PE=1 SV=2
Length = 695

Score = 33.9 bits (76), Expect = 0.30
Identities = 27/99 (27%), Positives = 47/99 (47%), Gaps = 7/99 (7%)
Frame = -1

Query: 417 EEKLSRSQVKSEEKALRSQVKS-------EEKVLISQIKAEEKQGVTKDTQLKASRDVSM 259
EEKL + + K ++ LR K E+K L +IK EE++ + L++ R ++
Sbjct: 319 EEKLRKREQKQRDRELRRNQKKLEKLQAEEQKQLQEKIKLEERKLLLAQRNLQSIRLIAE 378

Query: 258 AMATIAKLLLRESKGAITDLAFTKARCTQLEEEHKRLRE 142
++ + LRE + L Q +EE +RL+E
Sbjct: 379 LLSRAKAVKLREQEQKEEKLRL------QQQEERRRLQE 411


>sp|Q74IC0|SYT_LACJO Threonyl-tRNA synthetase OS=Lactobacillus
johnsonii GN=thrS PE=3 SV=1
Length = 643

Score = 33.5 bits (75), Expect = 0.40
Identities = 14/49 (28%), Positives = 30/49 (61%)
Frame = -1

Query: 426 TNSEEKLSRSQVKSEEKALRSQVKSEEKVLISQIKAEEKQGVTKDTQLK 280
T+ E+++ +++ EKA++ +K+ EK+ + +K E + + KD Q K
Sbjct: 107 TDKEDQIKVTELPDLEKAMQKAIKNGEKIEYTSMKKSELEEIFKDDQFK 155


>sp|Q0UJJ7|NST1_PHANO Stress response protein NST1 OS=Phaeosphaeria
nodorum GN=NST1 PE=3 SV=3
Length = 1202

Score = 33.5 bits (75), Expect = 0.40
Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 5/104 (4%)
Frame = -1

Query: 417 EEKLSRSQVKSEEKALRSQVKSEEKVLISQIKAEEK-----QGVTKDTQLKASRDVSMAM 253
EE+ + K +KA +Q + E+K QIKAEEK + K+ +LKA+ + +
Sbjct: 581 EEENEKKDQKEAKKAKEAQKRKEKKEKQRQIKAEEKAKKDAELAAKEAELKAAEEKRLEE 640

Query: 252 ATIAKLLLRESKGAITDLAFTKARCTQLEEEHKRLRENIDKGEK 121
+ R+ K A A + + + E KRL+E D+ ++
Sbjct: 641 QRKKREEQRKKKEA-ERKAQEEEKQRKEAERQKRLQEERDRQQE 683


tr_hit_id A9SY78
Definition tr|A9SY78|A9SY78_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 102
Score (bit) 80.9
E-value 7.0e-15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918754|Adiantum capillus-veneris mRNA, clone:
YMU001_000117_B03.
(435 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SY78|A9SY78_PHYPA Predicted protein OS=Physcomitrella paten... 81 7e-15
tr|B6TIU7|B6TIU7_MAIZE Putative uncharacterized protein OS=Zea m... 80 5e-14
tr|A7NXY6|A7NXY6_VITVI Chromosome chr6 scaffold_3, whole genome ... 80 5e-14
tr|Q9C8R6|Q9C8R6_ARATH Putative uncharacterized protein T1P2.7 (... 78 2e-13
tr|Q5WMS9|Q5WMS9_ORYSJ Os05g0315200 protein OS=Oryza sativa subs... 77 3e-13
tr|A3B2I6|A3B2I6_ORYSJ Putative uncharacterized protein OS=Oryza... 77 3e-13
tr|A2Y343|A2Y343_ORYSI Putative uncharacterized protein OS=Oryza... 77 3e-13
tr|Q84YE8|Q84YE8_SORBI Expressed protein-like protein OS=Sorghum... 75 1e-12
tr|A7Q9V5|A7Q9V5_VITVI Chromosome chr8 scaffold_68, whole genome... 75 2e-12
tr|Q2RBA7|Q2RBA7_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 75 2e-12
tr|B8BIS1|B8BIS1_ORYSI Putative uncharacterized protein OS=Oryza... 75 2e-12
tr|A3C814|A3C814_ORYSJ Putative uncharacterized protein OS=Oryza... 75 2e-12
tr|B8BNY6|B8BNY6_ORYSI Putative uncharacterized protein OS=Oryza... 74 3e-12
tr|A3CEE4|A3CEE4_ORYSJ Putative uncharacterized protein OS=Oryza... 74 3e-12
tr|Q9LZN4|Q9LZN4_ARATH Putative uncharacterized protein T7H20_20... 74 5e-12
tr|Q1STQ5|Q1STQ5_MEDTR Putative uncharacterized protein OS=Medic... 73 6e-12
tr|B6SSQ5|B6SSQ5_MAIZE Putative uncharacterized protein OS=Zea m... 73 6e-12
tr|Q2QYI4|Q2QYI4_ORYSJ Os12g0118200 protein OS=Oryza sativa subs... 71 2e-11
tr|O04342|O04342_ARATH Expressed protein (At2g30530/T6B20.12) OS... 70 4e-11
tr|A5C343|A5C343_VITVI Putative uncharacterized protein OS=Vitis... 63 6e-09
tr|A5BVV2|A5BVV2_VITVI Putative uncharacterized protein OS=Vitis... 62 1e-08
tr|Q0DH96|Q0DH96_ORYSJ Os05g0481700 protein OS=Oryza sativa subs... 61 3e-08
tr|A2Y5U2|A2Y5U2_ORYSI Putative uncharacterized protein OS=Oryza... 61 3e-08
tr|Q7X6C4|Q7X6C4_ORYSJ Os04g0228100 protein OS=Oryza sativa subs... 57 5e-07
tr|Q01MD0|Q01MD0_ORYSA H0209A05.2 protein OS=Oryza sativa GN=H02... 57 5e-07
tr|A2XPG5|A2XPG5_ORYSI Putative uncharacterized protein OS=Oryza... 57 5e-07
tr|B4F8G1|B4F8G1_MAIZE Putative uncharacterized protein OS=Zea m... 54 4e-06
tr|Q9SY05|Q9SY05_ARATH Putative uncharacterized protein T5J8.12 ... 52 1e-05
tr|A2R4M7|A2R4M7_ASPNC Remark: the ORF encoded protein is N-term... 44 0.005
tr|Q7RXI9|Q7RXI9_NEUCR Predicted protein OS=Neurospora crassa GN... 41 0.026

>tr|A9SY78|A9SY78_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_231634 PE=4 SV=1
Length = 384

Score = 80.9 bits (198), Expect(2) = 7e-15
Identities = 50/102 (49%), Positives = 61/102 (59%)
Frame = -1

Query: 324 KAEEKQGVTKDTQLKASRDVSMAMATIAKLLLRESKGAITDLAFTKARCTQLEEEHKRLR 145
KA+E G+ D QLKASRDV+MAMA+ AK+LLRE K DL F + RC QLEEE++RLR
Sbjct: 239 KADES-GLPGDIQLKASRDVAMAMASKAKMLLRELKTVRGDLTFLRDRCAQLEEENRRLR 297

Query: 144 ENIDKGEKHXXXXXXXXXXXXXXXXXXXLVQENAAYAREISF 19
E++ KG + L QENA YARE F
Sbjct: 298 ESVVKGTRPDEDDLVRLQLETLLAEKQRLQQENANYARENQF 339



Score = 22.7 bits (47), Expect(2) = 7e-15
Identities = 9/9 (100%), Positives = 9/9 (100%)
Frame = -3

Query: 28 NQFLHEVVQ 2
NQFLHEVVQ
Sbjct: 337 NQFLHEVVQ 345


>tr|B6TIU7|B6TIU7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 374

Score = 80.1 bits (196), Expect = 5e-14
Identities = 47/96 (48%), Positives = 55/96 (57%)
Frame = -1

Query: 294 DTQLKASRDVSMAMATIAKLLLRESKGAITDLAFTKARCTQLEEEHKRLRENIDKGEKHX 115
+TQLKASRDV+ AMA AKLLLRE K DLAF K RC QLEEE+K LRE+ DKG+
Sbjct: 226 ETQLKASRDVANAMAAKAKLLLRELKTVKADLAFAKERCAQLEEENKMLRESYDKGDNPE 285

Query: 114 XXXXXXXXXXXXXXXXXXLVQENAAYAREISFYMKL 7
L EN+ YARE F ++
Sbjct: 286 DDDLIRLQLETLLAEKARLAHENSVYARENRFLREI 321


>tr|A7NXY6|A7NXY6_VITVI Chromosome chr6 scaffold_3, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023914001
PE=4 SV=1
Length = 420

Score = 80.1 bits (196), Expect = 5e-14
Identities = 48/108 (44%), Positives = 61/108 (56%)
Frame = -1

Query: 330 QIKAEEKQGVTKDTQLKASRDVSMAMATIAKLLLRESKGAITDLAFTKARCTQLEEEHKR 151
Q + E + ++ QLKASRDV+MAMA AKLLLRE K DLAF K RC QLEEE++
Sbjct: 208 QAQMEPQLQADQEIQLKASRDVAMAMAAKAKLLLRELKTVKADLAFAKERCAQLEEENRI 267

Query: 150 LRENIDKGEKHXXXXXXXXXXXXXXXXXXXLVQENAAYAREISFYMKL 7
LRE+ +KG+ L QEN+ YARE F ++
Sbjct: 268 LREHHEKGDNPEDDDLIRLQLETLLAEKARLAQENSVYARENRFLREI 315


>tr|Q9C8R6|Q9C8R6_ARATH Putative uncharacterized protein T1P2.7
(Putative uncharacterized protein) OS=Arabidopsis
thaliana GN=Krtap3-1 PE=2 SV=1
Length = 389

Score = 78.2 bits (191), Expect = 2e-13
Identities = 46/98 (46%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
Frame = -1

Query: 297 KDTQLKASRDVSMAMATIAKLLLRESKGAITDLAFTKARCTQLEEEHKRLRENIDKGEKH 118
+++QLKASRDV+MA A AKLLLRE K DLAF K RC+QLEEE+KRLR+N DKG +
Sbjct: 182 RESQLKASRDVAMATAAKAKLLLRELKTVKADLAFAKERCSQLEEENKRLRDNRDKGNNN 241

Query: 117 XXXXXXXXXXXXXXXXXXXLV-QENAAYAREISFYMKL 7
+ EN+ YARE F ++
Sbjct: 242 PADDDLIRLQLETLLAEKARLAHENSIYARENRFLREI 279


>tr|Q5WMS9|Q5WMS9_ORYSJ Os05g0315200 protein OS=Oryza sativa subsp.
japonica GN=OJ1333_C12.2 PE=2 SV=1
Length = 419

Score = 77.4 bits (189), Expect = 3e-13
Identities = 46/96 (47%), Positives = 55/96 (57%)
Frame = -1

Query: 294 DTQLKASRDVSMAMATIAKLLLRESKGAITDLAFTKARCTQLEEEHKRLRENIDKGEKHX 115
+TQLKASRDV+ AMA AKLLLRE K DLAF K RC QLE+E+K LRE+ DKG+
Sbjct: 239 ETQLKASRDVANAMAAKAKLLLRELKTVKADLAFAKERCAQLEDENKILRESHDKGDNPE 298

Query: 114 XXXXXXXXXXXXXXXXXXLVQENAAYAREISFYMKL 7
L EN+ YARE F ++
Sbjct: 299 DDDLIRLQLETLLAEKARLAHENSVYARENRFLREI 334


>tr|A3B2I6|A3B2I6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_017258 PE=4 SV=1
Length = 441

Score = 77.4 bits (189), Expect = 3e-13
Identities = 46/96 (47%), Positives = 55/96 (57%)
Frame = -1

Query: 294 DTQLKASRDVSMAMATIAKLLLRESKGAITDLAFTKARCTQLEEEHKRLRENIDKGEKHX 115
+TQLKASRDV+ AMA AKLLLRE K DLAF K RC QLE+E+K LRE+ DKG+
Sbjct: 261 ETQLKASRDVANAMAAKAKLLLRELKTVKADLAFAKERCAQLEDENKILRESHDKGDNPE 320

Query: 114 XXXXXXXXXXXXXXXXXXLVQENAAYAREISFYMKL 7
L EN+ YARE F ++
Sbjct: 321 DDDLIRLQLETLLAEKARLAHENSVYARENRFLREI 356


>tr|A2Y343|A2Y343_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_19429 PE=4 SV=1
Length = 453

Score = 77.4 bits (189), Expect = 3e-13
Identities = 46/96 (47%), Positives = 55/96 (57%)
Frame = -1

Query: 294 DTQLKASRDVSMAMATIAKLLLRESKGAITDLAFTKARCTQLEEEHKRLRENIDKGEKHX 115
+TQLKASRDV+ AMA AKLLLRE K DLAF K RC QLE+E+K LRE+ DKG+
Sbjct: 261 ETQLKASRDVANAMAAKAKLLLRELKTVKADLAFAKERCAQLEDENKILRESHDKGDNPE 320

Query: 114 XXXXXXXXXXXXXXXXXXLVQENAAYAREISFYMKL 7
L EN+ YARE F ++
Sbjct: 321 DDDLIRLQLETLLAEKARLAHENSVYARENRFLREI 356


>tr|Q84YE8|Q84YE8_SORBI Expressed protein-like protein OS=Sorghum
bicolor GN=10 PE=4 SV=1
Length = 443

Score = 75.5 bits (184), Expect = 1e-12
Identities = 47/108 (43%), Positives = 57/108 (52%), Gaps = 1/108 (0%)
Frame = -1

Query: 327 IKAEEKQGVTKDTQLKASRDVSMAMATIAKLLLRESKGAITDLAFTKARCTQLEEEHKRL 148
+ + + ++T LKASRDV+ AMA AKLLLRE K DLAF K RC QLEEE+K L
Sbjct: 248 LSLRQPESAAQETGLKASRDVANAMAAKAKLLLRELKSVKADLAFAKQRCAQLEEENKLL 307

Query: 147 RENIDKGEK-HXXXXXXXXXXXXXXXXXXXLVQENAAYAREISFYMKL 7
RE KG K L QEN+ YARE F ++
Sbjct: 308 RETKQKGSKTEEDDDLIRVQLETLLAEKSRLAQENSTYARENRFLREI 355


>tr|A7Q9V5|A7Q9V5_VITVI Chromosome chr8 scaffold_68, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00033638001
PE=4 SV=1
Length = 339

Score = 75.1 bits (183), Expect = 2e-12
Identities = 44/97 (45%), Positives = 55/97 (56%)
Frame = -1

Query: 297 KDTQLKASRDVSMAMATIAKLLLRESKGAITDLAFTKARCTQLEEEHKRLRENIDKGEKH 118
++ Q+KASRDV+MA A AKLLLRE K DLAF K RC QLEEE+K LRE+ +KG+
Sbjct: 145 QENQIKASRDVAMATAAKAKLLLRELKTVKADLAFAKERCAQLEEENKILRESREKGDNP 204

Query: 117 XXXXXXXXXXXXXXXXXXXLVQENAAYAREISFYMKL 7
L EN+ YARE F ++
Sbjct: 205 ADDDLIRLQLETLLAEKARLAHENSVYARENRFLREI 241


>tr|Q2RBA7|Q2RBA7_ORYSJ Expressed protein OS=Oryza sativa subsp.
japonica GN=Os11g0118800 PE=2 SV=1
Length = 372

Score = 74.7 bits (182), Expect = 2e-12
Identities = 52/143 (36%), Positives = 74/143 (51%), Gaps = 3/143 (2%)
Frame = -1

Query: 426 TNSEEKLSRSQVKSEEKALRSQVKSE--EKVLISQIKAEEKQGVTKDTQLKASRDVSMAM 253
+N E+ + Q++ ++ S V + + + + ++ + ++TQLKASRDV+ AM
Sbjct: 138 SNIIEETKKIQIRRKQANSNSYVPNLAFDTLRPPNLSNDQAETAAQETQLKASRDVANAM 197

Query: 252 ATIAKLLLRESKGAITDLAFTKARCTQLEEEHKRLRENIDKGEK-HXXXXXXXXXXXXXX 76
A AKL+LRE K DLAF K RC QLEEE+K LRE KG K
Sbjct: 198 AAKAKLVLRELKTVKADLAFAKQRCAQLEEENKFLREAKQKGSKTEEDDDLIRVQLETLL 257

Query: 75 XXXXXLVQENAAYAREISFYMKL 7
L QEN+ YARE F ++
Sbjct: 258 AEKSRLAQENSMYARENRFLREI 280