BP918759
Clone id YMU001_000117_B08
Library
Length 448
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000117_B08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AACTGGAAGAATTCGCGGCCGCGAATACACAGTTGGCTCTTCTACGCTCGGGGGGTTCAC
TATTAAGTAGCCCCCCATATAGCGTACATTTGTAGGGTAGATTGAGCCCTCCTTTTTTAC
CTTGATTTTGTGGGAATGTTTAGAACCACAATCCATTCTAATCAATTGACATATCCACGT
GTAGGGAATGGCCATAATCCATTCTATCAAACTGACATATCCATGTGTAGGGAATAGCCA
ACATACGCGTGGTTCTAAAAATGTTAAATCAGTTTAGGATATGAAGGATGAACCGTCAAT
AGCAAAGTGCATGCACATCTGCGTTTCTTTTTTCGCACCAGAGAAGAAATCATGCCACAC
TCTGGCAGTCTCTGCTTCTTTGCTGCCGTTTCTGTAGAGAGTTTTGCCATGGCAGGTCGT
GGTAAGACGCCCGGCAAGAAGAGCATGC
■■Homology search results ■■ -
sp_hit_id P36168
Definition sp|P36168|YK76_YEAST Uncharacterized protein YKR096W OS=Saccharomyces cerevisiae
Align length 37
Score (bit) 30.0
E-value 3.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918759|Adiantum capillus-veneris mRNA, clone:
YMU001_000117_B08.
(421 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P36168|YK76_YEAST Uncharacterized protein YKR096W OS=Saccharo... 30 3.9
sp|Q4J965|GATA_SULAC Glutamyl-tRNA(Gln) amidotransferase subunit... 30 3.9
sp|Q9GZK4|OR2H1_HUMAN Olfactory receptor 2H1 OS=Homo sapiens GN=... 29 6.6
sp|Q5NCE8|MRS2_MOUSE Magnesium transporter MRS2 homolog, mitocho... 29 8.4
sp|Q5XPK0|SCARL_ARATH Scar-like domain-containing protein WAVE 5... 29 8.6

>sp|P36168|YK76_YEAST Uncharacterized protein YKR096W
OS=Saccharomyces cerevisiae GN=YKR096W PE=1 SV=1
Length = 1195

Score = 30.0 bits (66), Expect = 3.9
Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 4/37 (10%)
Frame = -2

Query: 234 FLEPRVCWLFPTHGYVSLIEWIMAIP----YTWICQL 136
F++P VC F TH +VSL I IP TW+ +L
Sbjct: 376 FMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRL 412


>sp|Q4J965|GATA_SULAC Glutamyl-tRNA(Gln) amidotransferase subunit A
OS=Sulfolobus acidocaldarius GN=gatA PE=3 SV=1
Length = 476

Score = 30.0 bits (66), Expect = 3.9
Identities = 15/54 (27%), Positives = 30/54 (55%)
Frame = -1

Query: 193 ICQFDRMDYGHSLHVDMSID*NGLWF*TFPQNQGKKGGLNLPYKCTLYGGLLNS 32
+ +FD + YG+S H D G+W T+ +N+G+ G+ + + L +L++
Sbjct: 312 LARFDGVRYGYSAHYD------GIWKDTYGKNRGEGFGIEVKRRIMLGSFILSA 359


>sp|Q9GZK4|OR2H1_HUMAN Olfactory receptor 2H1 OS=Homo sapiens
GN=OR2H1 PE=2 SV=1
Length = 316

Score = 29.3 bits (64), Expect = 6.6
Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 17/73 (23%)
Frame = -2

Query: 237 TFLEPRVCWLFPTHGYV-SLIEWIMAIPYT-------------WICQ---LIRMDCGSKH 109
T + PR+CW + +V SL++ I+ P T ++C+ LIR+ CG
Sbjct: 132 TIIHPRLCWQLASVAWVMSLVQSIVQTPSTLHLPFCPHQQIDDFLCEVPSLIRLSCGDTS 191

Query: 108 SHKIKVKKEGSIY 70
++I++ I+
Sbjct: 192 YNEIQLAVSSVIF 204


>sp|Q5NCE8|MRS2_MOUSE Magnesium transporter MRS2 homolog,
mitochondrial OS=Mus musculus GN=Mrs2 PE=2 SV=2
Length = 434

Score = 28.9 bits (63), Expect = 8.4
Identities = 14/44 (31%), Positives = 24/44 (54%)
Frame = -3

Query: 410 LPGVLPRPAMAKLSTETAAKKQRLPECGMISSLVRKKKRRCACT 279
LPG+LPR A + + TA + L CG ++ +R + + + T
Sbjct: 7 LPGLLPRAAQPRRALWTAVARLSLAACGGRATPLRSRSPKASST 50


>sp|Q5XPK0|SCARL_ARATH Scar-like domain-containing protein WAVE 5
OS=Arabidopsis thaliana GN=WAVE5 PE=1 SV=1
Length = 2028

Score = 28.9 bits (63), Expect = 8.6
Identities = 9/19 (47%), Positives = 15/19 (78%)
Frame = +1

Query: 145 YPRVGNGHNPFYQTDISMC 201
+PR+ NGH+ F Q+D+ +C
Sbjct: 113 HPRIRNGHSHFVQSDLPLC 131


tr_hit_id Q5CXA3
Definition tr|Q5CXA3|Q5CXA3_CRYPV Signal recognition particle SPR19 (Fragment) OS=Cryptosporidium parvum Iowa II
Align length 59
Score (bit) 33.5
E-value 5.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918759|Adiantum capillus-veneris mRNA, clone:
YMU001_000117_B08.
(421 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q5CXA3|Q5CXA3_CRYPV Signal recognition particle SPR19 (Fragme... 33 5.4
tr|A6C659|A6C659_9PLAN Peptidase M56, BlaR1 OS=Planctomyces mari... 33 9.2

>tr|Q5CXA3|Q5CXA3_CRYPV Signal recognition particle SPR19 (Fragment)
OS=Cryptosporidium parvum Iowa II GN=cgd6_1870 PE=4 SV=1
Length = 174

Score = 33.5 bits (75), Expect = 5.4
Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 7/59 (11%)
Frame = +2

Query: 182 KLTYPCVGNSQHTRGSKNVKSV*DMKDEPSIAKCMHICVSFFAPEK-------KSCHTL 337
K+ YP NS +T+ S + S+ ++P+IA+ +C+ P K K C TL
Sbjct: 20 KIIYPSYLNSNNTKSSGRLSSLIHCVEDPTIAEIAEVCIQLGIPCKVESKRYSKDCRTL 78


>tr|A6C659|A6C659_9PLAN Peptidase M56, BlaR1 OS=Planctomyces maris
DSM 8797 GN=PM8797T_31173 PE=4 SV=1
Length = 993

Score = 32.7 bits (73), Expect = 9.2
Identities = 20/57 (35%), Positives = 35/57 (61%), Gaps = 3/57 (5%)
Frame = -2

Query: 213 WLFPTHGYVSL-IEWIMAIPYTWICQLIRMDCG-SKHSHKIKVKK-EGSIYPTNVRY 52
W+ P+ GY+ L IEW ++ Q ++ G S+H+ ++VK+ +GS YPT +R+
Sbjct: 651 WVDPSQGYLPLRIEW------GYVDQKNQLAWGLSQHAEVLQVKQVDGSFYPTRIRF 701