BP918792
Clone id YMU001_000117_E06
Library
Length 549
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000117_E06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATTGACTTTTGCCATAATCTTCAATCAATCACTACAATGTTTAGACAATGGGACTTGATA
CAGGGGTTTAAGAATTCGATGGTTTCCTCAAATCCAATTGATAAATGCCGTTCTACCAAA
GTACCATCCAAAGCCAACAGTGTAGTGTCACCGACTGAAGACGAGTCATTGACAATGTCC
TTGGCCACTTCAATATGTAACAGCACCCTCAATCTCGAAAATGTTCAGTGTGACCCTGCT
GGGAGGCATTCAGAAGTAAGATATTAACCATCTTCAAGCAAGCCATAAGCTCCAAAGCAG
TCAGCCTCAAAAACCAGCATCAACGACAAGAAGTTAACCATTCGTCTTGACTAGAACAGT
AACAACTTGCGATACCTCTAAGATCACCATTAAGAGAAGGCTTTGTCATTGCACTTCAGC
TCCCATGGAGTGTTGAGATTGTAATTTGCCCCCTTAATTCTTCACAGCTTGCTCCTCATA
CCCAATGTGTAACTTGCCCTTGATGCATCACATGATCCAACCAATGATGTGGCACATGTC
TCCAGTTCT
■■Homology search results ■■ -
sp_hit_id Q04007
Definition sp|Q04007|YDR86_YEAST Uncharacterized protein YDR186C OS=Saccharomyces cerevisiae
Align length 76
Score (bit) 31.6
E-value 2.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918792|Adiantum capillus-veneris mRNA, clone:
YMU001_000117_E06.
(549 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q04007|YDR86_YEAST Uncharacterized protein YDR186C OS=Sacchar... 32 2.7

>sp|Q04007|YDR86_YEAST Uncharacterized protein YDR186C
OS=Saccharomyces cerevisiae GN=YDR186C PE=1 SV=1
Length = 877

Score = 31.6 bits (70), Expect = 2.7
Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 2/76 (2%)
Frame = +1

Query: 22 QSITTMFRQWDLIQGFKNSMVSSNPID--KCRSTKVPSKANSVVSPTEDESLTMSLATSI 195
QS T++ R + F+NS+++SN + RS + K+N +ES+T +TSI
Sbjct: 300 QSNTSLKRNSSSLLNFQNSVLTSNKDKSVRIRSLSINRKSNRAHMFKTNESITTIPSTSI 359

Query: 196 CNSTLNLENVQCDPAG 243
N N++ P+G
Sbjct: 360 NNLIGQESNLRKQPSG 375


tr_hit_id A1ANA1
Definition tr|A1ANA1|A1ANA1_PELPD Respiratory nitrite reductase (Cytochrome; ammonia-forming) OS=Pelobacter propionicus (strain DSM 2379)
Align length 62
Score (bit) 33.9
E-value 5.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918792|Adiantum capillus-veneris mRNA, clone:
YMU001_000117_E06.
(549 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A1ANA1|A1ANA1_PELPD Respiratory nitrite reductase (Cytochrome... 34 5.8
tr|A6RA22|A6RA22_AJECN Predicted protein OS=Ajellomyces capsulat... 33 7.5
tr|A0BZE1|A0BZE1_PARTE Chromosome undetermined scaffold_139, who... 33 9.8

>tr|A1ANA1|A1ANA1_PELPD Respiratory nitrite reductase (Cytochrome;
ammonia-forming) OS=Pelobacter propionicus (strain DSM
2379) GN=Ppro_1200 PE=3 SV=1
Length = 487

Score = 33.9 bits (76), Expect = 5.8
Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
Frame = -3

Query: 517 DHVMHQGQVTHWV*GASCEELRGQITISTLH-GS*SAMTKPSLNGDLRGIASCYCSSQDE 341
++ ++ HW GASC + T +H S +T P NG L+G C+ SQ E
Sbjct: 283 EYELYSNNSVHWKGGASCADCHMPFTKVGVHKASDHRITSPLKNG-LKGCIQCHAESQ-E 340

Query: 340 WL 335
WL
Sbjct: 341 WL 342


>tr|A6RA22|A6RA22_AJECN Predicted protein OS=Ajellomyces capsulata
(strain NAm1 / WU24) GN=HCAG_05810 PE=4 SV=1
Length = 1676

Score = 33.5 bits (75), Expect = 7.5
Identities = 14/28 (50%), Positives = 21/28 (75%)
Frame = +2

Query: 272 LQASHKLQSSQPQKPASTTRS*PFVLTR 355
L+ SH +S P++P+STTR+ P +LTR
Sbjct: 58 LKGSHPTAASSPKQPSSTTRNAPVILTR 85


>tr|A0BZE1|A0BZE1_PARTE Chromosome undetermined scaffold_139, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00033761001 PE=3 SV=1
Length = 490

Score = 33.1 bits (74), Expect = 9.8
Identities = 15/37 (40%), Positives = 20/37 (54%)
Frame = -2

Query: 518 GSCDASRASYTLGMRSKL*RIKGANYNLNTPWELKCN 408
G C + A T+ M S +IKG N +L+ W L CN
Sbjct: 247 GQCGSCYAIATMSMLSARLKIKGENVDLSPQWSLNCN 283