BP918794
Clone id YMU001_000117_E08
Library
Length 478
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000117_E08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CCCTCGGATTGATGATATACTTGATAAGTTGCAGGGTGCGTGTCTTTGTCGCATAGACTT
AAAGAGTGGGTATCATCAGATACGGATCGCCCCTGAGGATGTCCATAAGACTGCTTTCCG
CACAACCTTTGGACTATATGAATTCTTGGTAATGCCTTTCGGCTTGACCAATGCTCCTGC
GACGTTCAATCGCATGATGGACCGCATTTTCAGCCCGTATCGAGCTTTTACGGGAGTATT
CTTTGACGACATACTCATCTTCTCTAAGTCAGAAGAGGAACATCGGAAGCACTTGGACTT
AGTGTTTCAAGAATTGTGAAAGCATGAGTCGCATGTGAATGCAAAGAAGAGCGAGTTCTT
TCTCTCTGAGATACACTATCTCGGCCATATAGTCTCCCACAATAAAGTGAGTATGGATCC
TGCCAAGATCCGAGTGGTAGAAGATTGGCCTATTCCCACTACGGTACATGATGTACGT
■■Homology search results ■■ -
sp_hit_id Q7LHG5
Definition sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae
Align length 156
Score (bit) 130.0
E-value 3.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918794|Adiantum capillus-veneris mRNA, clone:
YMU001_000117_E08.
(478 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Sa... 130 3e-30
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Sa... 130 3e-30
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from tra... 130 3e-30
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from tra... 125 1e-28
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from tra... 120 2e-27
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from tra... 115 1e-25
sp|Q05654|RTF21_SCHPO Retrotransposable element Tf2 155 kDa prot... 107 4e-23
sp|Q9UR07|RTF23_SCHPO Retrotransposable element Tf2 155 kDa prot... 104 2e-22
sp|Q9C0R2|RTF22_SCHPO Retrotransposable element Tf2 155 kDa prot... 104 2e-22
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from tra... 99 1e-20
sp|P19199|POL_COYMV Putative polyprotein OS=Commelina yellow mot... 98 2e-20
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic ... 94 4e-19
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic ... 94 4e-19
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic ... 94 4e-19
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic ... 94 4e-19
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic ... 92 9e-19
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform vi... 92 1e-18
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oeno... 89 1e-17
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorha... 86 7e-17
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic m... 77 5e-14
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus... 77 5e-14
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf... 74 3e-13
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing... 73 6e-13
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing... 73 6e-13
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus ... 69 1e-11
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched rin... 62 2e-09
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pr... 58 2e-08
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=p... 57 3e-08
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (... 53 6e-07
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogen... 53 8e-07

>sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY3B-I PE=3 SV=2
Length = 1498

Score = 130 bits (327), Expect = 3e-30
Identities = 72/156 (46%), Positives = 94/156 (60%), Gaps = 1/156 (0%)
Frame = +2

Query: 2 PRIDDILDKLQGACL-CRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAP 178
PRID++L ++ A + +DL SGYHQI + P+D +KTAF T G YE+ VMPFGL NAP
Sbjct: 693 PRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAP 752

Query: 179 ATFNRMMDRIFSPYRAFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSEF 358
+TF R M F R F V+ DDILIFS+S EEH KHLD V + L V KK +F
Sbjct: 753 STFARYMADTFRDLR-FVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKF 811

Query: 359 FLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTV 466
E +LG+ + K++ K + D+P P TV
Sbjct: 812 ASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTV 847


>sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY3B-G PE=1 SV=3
Length = 1547

Score = 130 bits (327), Expect = 3e-30
Identities = 72/156 (46%), Positives = 94/156 (60%), Gaps = 1/156 (0%)
Frame = +2

Query: 2 PRIDDILDKLQGACL-CRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAP 178
PRID++L ++ A + +DL SGYHQI + P+D +KTAF T G YE+ VMPFGL NAP
Sbjct: 667 PRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAP 726

Query: 179 ATFNRMMDRIFSPYRAFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSEF 358
+TF R M F R F V+ DDILIFS+S EEH KHLD V + L V KK +F
Sbjct: 727 STFARYMADTFRDLR-FVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKF 785

Query: 359 FLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTV 466
E +LG+ + K++ K + D+P P TV
Sbjct: 786 ASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTV 821


>sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from
transposon 17.6 OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1058

Score = 130 bits (327), Expect = 3e-30
Identities = 71/162 (43%), Positives = 98/162 (60%), Gaps = 3/162 (1%)
Frame = +2

Query: 2 PRIDDILDKLQGAC--LCRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNA 175
P +D+IL KL G C IDL G+HQI + PE V KTAF T G YE+L MPFGL NA
Sbjct: 283 PNMDEILGKL-GRCNYFTTIDLAKGFHQIEMDPESVSKTAFSTKHGHYEYLRMPFGLKNA 341

Query: 176 PATFNRMMDRIFSP-YRAFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKS 352
PATF R M+ I P V+ DDI++FS S +EH + L LVF++L K + K
Sbjct: 342 PATFQRCMNDILRPLLNKHCLVYLDDIIVFSTSLDEHLQSLGLVFEKLAKANLKLQLDKC 401

Query: 353 EFFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
EF E +LGH+++ + + +P KI ++ +PIPT +++
Sbjct: 402 EFLKQETTFLGHVLTPDGIKPNPEKIEAIQKYPIPTKPKEIK 443


>sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from
transposon 297 OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1059

Score = 125 bits (313), Expect = 1e-28
Identities = 70/162 (43%), Positives = 94/162 (58%), Gaps = 3/162 (1%)
Frame = +2

Query: 2 PRIDDILDKLQGAC--LCRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNA 175
P +D+IL KL G C IDL G+HQI + E + KTAF T G YE+L MPFGL NA
Sbjct: 282 PNMDEILGKL-GKCQYFTTIDLAKGFHQIEMDEESISKTAFSTKSGHYEYLRMPFGLRNA 340

Query: 176 PATFNRMMDRIFSP-YRAFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKS 352
PATF R M+ I P V+ DDI+IFS S EH + LVF +L + K
Sbjct: 341 PATFQRCMNNILRPLLNKHCLVYLDDIIIFSTSLTEHLNSIQLVFTKLADANLKLQLDKC 400

Query: 353 EFFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
EF E ++LGHIV+ + + +P K++ + +PIPT ++R
Sbjct: 401 EFLKKEANFLGHIVTPDGIKPNPIKVKAIVSYPIPTKDKEIR 442


>sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from
transposon opus OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1003

Score = 120 bits (302), Expect = 2e-27
Identities = 61/143 (42%), Positives = 90/143 (62%), Gaps = 1/143 (0%)
Frame = +2

Query: 53 IDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAPATFNRMMDRIFSPYRA-F 229
+DL SG+HQI + D+ KTAF T G YEFL +PFGL NAPA F RM+D I +
Sbjct: 217 LDLTSGFHQIHMKESDIPKTAFSTLNGKYEFLRLPFGLKNAPAIFQRMIDDILREHIGKV 276

Query: 230 TGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSEFFLSEIHYLGHIVSHNKV 409
V+ DDI++FS+ + H K+L LV L K VN +KS F +++ +LG+IV+ + +
Sbjct: 277 CYVYIDDIIVFSEDYDTHWKNLRLVLASLSKANLQVNLEKSHFLDTQVEFLGYIVTADGI 336

Query: 410 SMDPAKIRVVEDWPIPTTVHDVR 478
DP K+R + + P PT+V +++
Sbjct: 337 KADPKKVRAISEMPPPTSVKELK 359


>sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from
transposon gypsy OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1035

Score = 115 bits (287), Expect = 1e-25
Identities = 57/143 (39%), Positives = 85/143 (59%), Gaps = 1/143 (0%)
Frame = +2

Query: 53 IDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAPATFNRMMDRIF-SPYRAF 229
+DLKSGYHQI +A D KT+F G YEF +PFGL NA + F R +D +
Sbjct: 276 LDLKSGYHQIYLAEHDREKTSFSVNGGKYEFCRLPFGLRNASSIFQRALDDVLREQIGKI 335

Query: 230 TGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSEFFLSEIHYLGHIVSHNKV 409
V+ DD++IFS++E +H +H+D V + L V+ +K+ FF + YLG IVS +
Sbjct: 336 CYVYVDDVIIFSENESDHVRHIDTVLKCLIDANMRVSQEKTRFFKESVEYLGFIVSKDGT 395

Query: 410 SMDPAKIRVVEDWPIPTTVHDVR 478
DP K++ ++++P P V+ VR
Sbjct: 396 KSDPEKVKAIQEYPEPDCVYKVR 418


>sp|Q05654|RTF21_SCHPO Retrotransposable element Tf2 155 kDa protein
type 1 OS=Schizosaccharomyces pombe GN=Tf2-1 PE=2 SV=1
Length = 1333

Score = 107 bits (266), Expect = 4e-23
Identities = 60/161 (37%), Positives = 91/161 (56%), Gaps = 2/161 (1%)
Frame = +2

Query: 2 PRIDDILDKLQGACL-CRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAP 178
P I+ +L K+QG+ + ++DLKS YH IR+ D HK AFR G++E+LVMP+G++ AP
Sbjct: 483 PLIEQLLAKIQGSTIFTKLDLKSAYHLIRVRKGDEHKLAFRCPRGVFEYLVMPYGISTAP 542

Query: 179 ATFNRMMDRIFSPYR-AFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSE 355
A F ++ I + + + DDILI SKSE EH KH+ V Q+L +N K E
Sbjct: 543 AHFQYFINTILGEAKESHVVCYMDDILIHSKSESEHVKHVKDVLQKLKNANLIINQAKCE 602

Query: 356 FFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
F S++ ++G+ +S + I V W P ++R
Sbjct: 603 FHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELR 643


>sp|Q9UR07|RTF23_SCHPO Retrotransposable element Tf2 155 kDa protein
type 3 OS=Schizosaccharomyces pombe GN=Tf2-11 PE=4 SV=1
Length = 1333

Score = 104 bits (259), Expect = 2e-22
Identities = 59/161 (36%), Positives = 91/161 (56%), Gaps = 2/161 (1%)
Frame = +2

Query: 2 PRIDDILDKLQGACL-CRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAP 178
P I+ +L K+QG+ + ++DLKS YH IR+ D HK AFR G++E+LVMP+G++ AP
Sbjct: 483 PLIEQLLAKIQGSTIFTKLDLKSAYHLIRVRKGDEHKLAFRCPRGVFEYLVMPYGISIAP 542

Query: 179 ATFNRMMDRIFSPYR-AFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSE 355
A F ++ I + + + D+ILI SKSE EH KH+ V Q+L +N K E
Sbjct: 543 AHFQYFINTILGEVKESHVVCYMDNILIHSKSESEHVKHVKDVLQKLKNANLIINQAKCE 602

Query: 356 FFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
F S++ ++G+ +S + I V W P ++R
Sbjct: 603 FHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELR 643


>sp|Q9C0R2|RTF22_SCHPO Retrotransposable element Tf2 155 kDa protein
type 2 OS=Schizosaccharomyces pombe GN=Tf2-7 PE=2 SV=1
Length = 1333

Score = 104 bits (259), Expect = 2e-22
Identities = 59/161 (36%), Positives = 91/161 (56%), Gaps = 2/161 (1%)
Frame = +2

Query: 2 PRIDDILDKLQGACL-CRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAP 178
P I+ +L K+QG+ + ++DLKS YH IR+ D HK AFR G++E+LVMP+G++ AP
Sbjct: 483 PLIEQLLAKIQGSTIFTKLDLKSAYHLIRVRKGDEHKLAFRCPRGVFEYLVMPYGISIAP 542

Query: 179 ATFNRMMDRIFSPYR-AFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSE 355
A F ++ I + + + D+ILI SKSE EH KH+ V Q+L +N K E
Sbjct: 543 AHFQYFINTILGEVKESHVVCYMDNILIHSKSESEHVKHVKDVLQKLKNANLIINQAKCE 602

Query: 356 FFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
F S++ ++G+ +S + I V W P ++R
Sbjct: 603 FHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELR 643


>sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from
transposon 412 OS=Drosophila melanogaster GN=POL PE=4
SV=1
Length = 1237

Score = 98.6 bits (244), Expect = 1e-20
Identities = 61/166 (36%), Positives = 92/166 (55%), Gaps = 7/166 (4%)
Frame = +2

Query: 2 PRIDDILDKLQGA----CLCRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLT 169
PRIDDILD+L A CL DL SG+HQI + T+F T+ G Y F +PFGL
Sbjct: 391 PRIDDILDQLGRAKYFSCL---DLMSGFHQIELDEGSRDITSFSTSNGSYRFTRLPFGLK 447

Query: 170 NAPATFNRMMDRIFS---PYRAFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVN 340
AP +F RMM FS P +AF ++ DD+++ SE+ K+L VF + ++ ++
Sbjct: 448 IAPNSFQRMMTIAFSGIEPSQAF--LYMDDLIVIGCSEKHMLKNLTEVFGKCREYNLKLH 505

Query: 341 AKKSEFFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
+K FF+ E+ +LGH + + D K V++++P+P R
Sbjct: 506 PEKCSFFMHEVTFLGHKCTDKGILPDDKKYDVIQNYPVPHDADSAR 551


tr_hit_id O64892
Definition tr|O64892|O64892_ANACO Polyprotein (Fragment) OS=Ananas comosus
Align length 161
Score (bit) 183.0
E-value 3.0e-45
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918794|Adiantum capillus-veneris mRNA, clone:
YMU001_000117_E08.
(478 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|O64892|O64892_ANACO Polyprotein (Fragment) OS=Ananas comosus ... 183 3e-45
tr|B4YF15|B4YF15_ANACO Polyprotein (Fragment) OS=Ananas comosus ... 177 3e-43
tr|Q7XUA3|Q7XUA3_ORYSJ OSJNBa0019D11.8 protein OS=Oryza sativa s... 175 1e-42
tr|Q7XEF2|Q7XEF2_ORYSJ Retrotransposon protein, putative, Ty3-gy... 175 1e-42
tr|Q2QR60|Q2QR60_ORYSJ Retrotransposon protein, putative, Ty3-gy... 175 1e-42
tr|Q01I31|Q01I31_ORYSA OSIGBa0145G11.8 protein OS=Oryza sativa G... 175 1e-42
tr|Q9XE85|Q9XE85_SORBI Polyprotein OS=Sorghum bicolor PE=4 SV=1 174 1e-42
tr|Q0DC29|Q0DC29_ORYSJ Os06g0493000 protein OS=Oryza sativa subs... 173 3e-42
tr|A2I5E5|A2I5E5_BETVU Retrotransposon protein OS=Beta vulgaris ... 173 3e-42
tr|Q7XX43|Q7XX43_ORYSJ OSJNBa0059D20.6 protein OS=Oryza sativa s... 173 4e-42
tr|Q2R193|Q2R193_ORYSJ Retrotransposon protein, putative, Ty3-gy... 173 4e-42
tr|Q8W5B7|Q8W5B7_ORYSA Putative polyprotein OS=Oryza sativa GN=O... 172 6e-42
tr|Q65WY1|Q65WY1_ORYSJ Putative polyprotein OS=Oryza sativa subs... 172 6e-42
tr|Q2R4W7|Q2R4W7_ORYSJ Retrotransposon protein, putative, Ty3-gy... 172 6e-42
tr|Q10GH3|Q10GH3_ORYSJ Retrotransposon protein, putative, Ty3-gy... 172 6e-42
tr|Q7XM76|Q7XM76_ORYSA OSJNBa0079C19.6 protein OS=Oryza sativa G... 172 7e-42
tr|Q7XK08|Q7XK08_ORYSJ OSJNBa0061C08.12 protein OS=Oryza sativa ... 172 7e-42
tr|Q6UU19|Q6UU19_ORYSJ Putative gag-pol polyprotein OS=Oryza sat... 172 7e-42
tr|Q2RB45|Q2RB45_ORYSJ Retrotransposon protein, putative, Ty3-gy... 172 7e-42
tr|Q2QR37|Q2QR37_ORYSJ Retrotransposon protein, putative, Ty3-gy... 172 7e-42
tr|Q10NV6|Q10NV6_ORYSJ Retrotransposon protein, putative, Ty3-gy... 172 7e-42
tr|Q6L3S3|Q6L3S3_SOLDE Putative gag-pol polyprotein, identical O... 172 1e-41
tr|Q6L3S2|Q6L3S2_SOLDE Putative retrotransposon protein, identic... 172 1e-41
tr|Q60DH0|Q60DH0_ORYSJ Putative polyprotein OS=Oryza sativa subs... 172 1e-41
tr|Q53PB2|Q53PB2_ORYSJ Retrotransposon protein, putative, Ty3-gy... 172 1e-41
tr|Q9AYB6|Q9AYB6_ORYSA Polyprotein OS=Oryza sativa GN=OSJNBa0094... 171 1e-41
tr|Q94I04|Q94I04_ORYSA Putative retroelement OS=Oryza sativa GN=... 171 1e-41
tr|Q8S6Z5|Q8S6Z5_ORYSJ Putative polyprotein OS=Oryza sativa subs... 171 1e-41
tr|Q8LSR7|Q8LSR7_ORYSJ Putative polyprotein (Retrotransposon pro... 171 1e-41
tr|Q7XS19|Q7XS19_ORYSJ OSJNBa0080E14.17 protein (OSJNBa0022F16.2... 171 1e-41

>tr|O64892|O64892_ANACO Polyprotein (Fragment) OS=Ananas comosus
PE=4 SV=1
Length = 871

Score = 183 bits (465), Expect = 3e-45
Identities = 86/161 (53%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
Frame = +2

Query: 2 PRIDDILDKLQGACL-CRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAP 178
PRIDD+ D+LQG+C+ +IDL+SGYHQ++I PEDV KTAFRT +G YEF VMPFGLTNAP
Sbjct: 88 PRIDDLFDQLQGSCVYSKIDLQSGYHQLKIKPEDVSKTAFRTRYGHYEFAVMPFGLTNAP 147

Query: 179 ATFNRMMDRIFSPY-RAFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSE 355
F +M+R+F PY F VF DDIL++S+S+ +H +HL +V Q L + E +V KK E
Sbjct: 148 TAFMDLMNRVFKPYLDRFVVVFIDDILVYSRSDADHEEHLRIVLQVLREKELYVKLKKCE 207

Query: 356 FFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
F+L E+ +LGH++S + +++DP KI ++DWP T+V ++R
Sbjct: 208 FWLREVAFLGHLISGSGIAVDPKKIEAIKDWPRLTSVTEIR 248


>tr|B4YF15|B4YF15_ANACO Polyprotein (Fragment) OS=Ananas comosus
PE=4 SV=1
Length = 953

Score = 177 bits (448), Expect = 3e-43
Identities = 87/161 (54%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
Frame = +2

Query: 2 PRIDDILDKLQGACL-CRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAP 178
P +D++LD+L GA L +DL+SGYHQIR+ +D+ KTAFRT G YEFLVMPFGLTNAP
Sbjct: 300 PLVDELLDELSGAKLFSELDLRSGYHQIRMHADDISKTAFRTHEGHYEFLVMPFGLTNAP 359

Query: 179 ATFNRMMDRIFSPY-RAFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSE 355
+TF +M+ IF PY R F VFFDDIL++SK EEH HL FQ L +H V KK
Sbjct: 360 STFQGLMNHIFKPYLRRFILVFFDDILVYSKGVEEHLCHLRTTFQVLRQHSLFVRRKKCI 419

Query: 356 FFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
F ++ YLGH++SH VSMD K+ +++WP+PTT ++R
Sbjct: 420 FAAVQLEYLGHVISHEGVSMDKKKVEAIQEWPLPTTAKELR 460


>tr|Q7XUA3|Q7XUA3_ORYSJ OSJNBa0019D11.8 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0019D11.8 PE=4 SV=1
Length = 1470

Score = 175 bits (443), Expect = 1e-42
Identities = 85/161 (52%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
Frame = +2

Query: 2 PRIDDILDKLQGA-CLCRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAP 178
PRIDD+ D+L+GA +IDL+SGYHQ++I ED+ KTAF T +GLYEF VM FGLTNAP
Sbjct: 613 PRIDDLFDQLKGAKVFSKIDLRSGYHQLKIRTEDIPKTAFSTRYGLYEFTVMSFGLTNAP 672

Query: 179 ATFNRMMDRIFSPYR-AFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSE 355
A F +M+++F Y F VF DDILI+SK EEEH +HL LV Q+L KH+ + K E
Sbjct: 673 AYFMNLMNKVFMDYLDKFVVVFIDDILIYSKDEEEHAEHLRLVLQKLRKHKLYAKFSKCE 732

Query: 356 FFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
F+L E+ +LGH++S V++DPAK+ V +W P +V ++R
Sbjct: 733 FWLKEVAFLGHVISAGGVAVDPAKVEAVTEWKAPKSVTEIR 773


>tr|Q7XEF2|Q7XEF2_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os10g28930 PE=4 SV=1
Length = 1470

Score = 175 bits (443), Expect = 1e-42
Identities = 85/161 (52%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
Frame = +2

Query: 2 PRIDDILDKLQGA-CLCRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAP 178
PRIDD+ D+L+GA +IDL+SGYHQ++I ED+ KTAF T +GLYEF VM FGLTNAP
Sbjct: 613 PRIDDLFDQLKGAKVFSKIDLRSGYHQLKIRTEDIPKTAFSTRYGLYEFTVMSFGLTNAP 672

Query: 179 ATFNRMMDRIFSPYR-AFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSE 355
A F +M+++F Y F VF DDILI+SK EEEH +HL LV Q+L KH+ + K E
Sbjct: 673 AYFMNLMNKVFMDYLDKFVVVFIDDILIYSKDEEEHAEHLRLVLQKLRKHKLYAKFSKCE 732

Query: 356 FFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
F+L E+ +LGH++S V++DPAK+ V +W P +V ++R
Sbjct: 733 FWLKEVAFLGHVISAGGVAVDPAKVEAVTEWKAPKSVTEIR 773


>tr|Q2QR60|Q2QR60_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os12g28690 PE=4 SV=1
Length = 1470

Score = 175 bits (443), Expect = 1e-42
Identities = 85/161 (52%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
Frame = +2

Query: 2 PRIDDILDKLQGA-CLCRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAP 178
PRIDD+ D+L+GA +IDL+SGYHQ++I ED+ KTAF T +GLYEF VM FGLTNAP
Sbjct: 613 PRIDDLFDQLKGAKVFSKIDLRSGYHQLKIRTEDIPKTAFSTRYGLYEFTVMSFGLTNAP 672

Query: 179 ATFNRMMDRIFSPYR-AFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSE 355
A F +M+++F Y F VF DDILI+SK EEEH +HL LV Q+L KH+ + K E
Sbjct: 673 AYFMNLMNKVFMDYLDKFVVVFIDDILIYSKDEEEHAEHLRLVLQKLRKHKLYAKFSKCE 732

Query: 356 FFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
F+L E+ +LGH++S V++DPAK+ V +W P +V ++R
Sbjct: 733 FWLKEVAFLGHVISAGGVAVDPAKVEAVTEWKAPKSVTEIR 773


>tr|Q01I31|Q01I31_ORYSA OSIGBa0145G11.8 protein OS=Oryza sativa
GN=OSIGBa0145G11.8 PE=4 SV=1
Length = 1470

Score = 175 bits (443), Expect = 1e-42
Identities = 85/161 (52%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
Frame = +2

Query: 2 PRIDDILDKLQGA-CLCRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAP 178
PRIDD+ D+L+GA +IDL+SGYHQ++I ED+ KTAF T +GLYEF VM FGLTNAP
Sbjct: 613 PRIDDLFDQLKGAKVFSKIDLRSGYHQLKIRTEDIPKTAFSTRYGLYEFTVMSFGLTNAP 672

Query: 179 ATFNRMMDRIFSPYR-AFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSE 355
A F +M+++F Y F VF DDILI+SK EEEH +HL LV Q+L KH+ + K E
Sbjct: 673 AYFMNLMNKVFMDYLDKFVVVFIDDILIYSKDEEEHAEHLRLVLQKLRKHKLYAKFSKCE 732

Query: 356 FFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
F+L E+ +LGH++S V++DPAK+ V +W P +V ++R
Sbjct: 733 FWLKEVAFLGHVISAGGVAVDPAKVEAVTEWKAPKSVTEIR 773


>tr|Q9XE85|Q9XE85_SORBI Polyprotein OS=Sorghum bicolor PE=4 SV=1
Length = 1484

Score = 174 bits (442), Expect = 1e-42
Identities = 83/161 (51%), Positives = 119/161 (73%), Gaps = 2/161 (1%)
Frame = +2

Query: 2 PRIDDILDKLQGACL-CRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAP 178
PRIDD+ D+L+GAC+ +IDL+SGYHQ++I D+ KTAF T +GLYE+ VM FGLTNAP
Sbjct: 631 PRIDDLFDQLRGACVFSKIDLRSGYHQLKIRNSDIPKTAFTTRYGLYEYTVMSFGLTNAP 690

Query: 179 ATFNRMMDRIFSPYR-AFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSE 355
A F MM+++F Y F VF DDIL+FSK++EEH +HL LV Q+L +H+ + K E
Sbjct: 691 AYFMYMMNKVFMEYLDKFVVVFIDDILVFSKTKEEHAEHLRLVLQKLREHKLYAKRSKCE 750

Query: 356 FFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
F+L E+ +LGH+VS+ +++DP+K++ V +W PT V ++R
Sbjct: 751 FWLEEVSFLGHVVSNGGIAVDPSKVKDVLNWKPPTDVSEIR 791


>tr|Q0DC29|Q0DC29_ORYSJ Os06g0493000 protein OS=Oryza sativa subsp.
japonica GN=Os06g0493000 PE=4 SV=1
Length = 1573

Score = 173 bits (439), Expect = 3e-42
Identities = 86/161 (53%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
Frame = +2

Query: 2 PRIDDILDKLQGACL-CRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAP 178
P I+D+LD+LQGA + +IDL+SGYHQIR+ DVHKTAF T G +E+LVMPFGLTNAP
Sbjct: 746 PVIEDLLDELQGAQIFSKIDLRSGYHQIRMHAADVHKTAFSTHLGHFEYLVMPFGLTNAP 805

Query: 179 ATFNRMMDRIFSPY-RAFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSE 355
ATF +M++I +PY R F VFFDDILI+SKS EH +HL LV Q L H+ K
Sbjct: 806 ATFQALMNKILAPYLRKFVLVFFDDILIYSKSATEHAQHLSLVLQLLRHHQLFAKPSKCV 865

Query: 356 FFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
F ++ YLG+I+S + V+ DP K++ V++WP PT++ ++R
Sbjct: 866 FGQDQVEYLGYIISSSGVATDPVKVQAVQNWPTPTSITELR 906


>tr|A2I5E5|A2I5E5_BETVU Retrotransposon protein OS=Beta vulgaris PE=4
SV=1
Length = 1501

Score = 173 bits (439), Expect = 3e-42
Identities = 86/161 (53%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
Frame = +2

Query: 2 PRIDDILDKLQGACL-CRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAP 178
PRIDD+ D+L GA + +IDL+SGYHQ+R+A +DV KTAFRT +G YEF VMPFGLTNAP
Sbjct: 631 PRIDDLFDQLNGASVFSKIDLRSGYHQLRVADKDVPKTAFRTRYGHYEFTVMPFGLTNAP 690

Query: 179 ATFNRMMDRIFSPYR-AFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSE 355
A F +M+RIF + F VF DDILI+S++E EH +HL ++ + L K++ + K E
Sbjct: 691 AIFMDLMNRIFHEFLDKFVVVFIDDILIYSRNETEHDEHLRIILETLRKNQLYAKFSKCE 750

Query: 356 FFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
F L ++ +LGH VS VS+DPAKI+ V +WP P +V D+R
Sbjct: 751 FRLEKVAFLGHFVSKEGVSVDPAKIQAVSEWPTPKSVTDIR 791


>tr|Q7XX43|Q7XX43_ORYSJ OSJNBa0059D20.6 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0059D20.6 PE=4 SV=2
Length = 1470

Score = 173 bits (438), Expect = 4e-42
Identities = 84/161 (52%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
Frame = +2

Query: 2 PRIDDILDKLQGA-CLCRIDLKSGYHQIRIAPEDVHKTAFRTTFGLYEFLVMPFGLTNAP 178
PRID++ D+L+GA +IDL+SGYHQ++I ED+ KTAF T +GLYEF VM FGLTNAP
Sbjct: 613 PRIDNLFDQLKGAKVFSKIDLRSGYHQLKIRTEDIPKTAFSTRYGLYEFTVMSFGLTNAP 672

Query: 179 ATFNRMMDRIFSPYR-AFTGVFFDDILIFSKSEEEHRKHLDLVFQEL*KHESHVNAKKSE 355
A F +M+++F Y F VF DDILI+SK EEEH +HL LV Q+L KH+ + K E
Sbjct: 673 AYFMNLMNKVFMEYLDKFVVVFIDDILIYSKDEEEHAEHLRLVLQKLRKHKLYAKFSKCE 732

Query: 356 FFLSEIHYLGHIVSHNKVSMDPAKIRVVEDWPIPTTVHDVR 478
F+L E+ +LGH++S V++DPAK+ V +W P +V ++R
Sbjct: 733 FWLKEVAFLGHVISAGGVAVDPAKVEAVTEWKAPKSVTEIR 773