BP918822
Clone id YMU001_000117_H01
Library
Length 337
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000117_H01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TCAAAGCCGACACTGACCAATTGGAGGTGTCCCTTCCATACAATGCCTCTTCTGCTGCTC
TCCCTCCAAGAAAGACCTGCAGTCTATGAAGAAGCTGTGGCCTCGCTTTCAAAAAAGTAG
CCTTCATCATCCAAACGCTGAAAAATTGTACGAGAGAGCGTCTCGCCACGAGGAACAATT
GATACACGCTCGCAGTATTCCAGTTTGGCTCCTTCCAAGCGACGAAGTATGTGGGTAGTC
ATCGACAGCCCAACTTCAAGGGTTGCCATTCGTCGATGCACAGGAAGCCCACGGACGACT
CCGAATCGTTGTGGGCCAACAGTGATCCGATCGACTG
■■Homology search results ■■ -
sp_hit_id P54813
Definition sp|P54813|YME1_CAEEL Protein YME1 homolog OS=Caenorhabditis elegans
Align length 32
Score (bit) 30.4
E-value 0.028
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918822|Adiantum capillus-veneris mRNA, clone:
YMU001_000117_H01.
(337 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P54813|YME1_CAEEL Protein YME1 homolog OS=Caenorhabditis eleg... 30 0.028
sp|O78516|FTSH_GUITH Cell division protease ftsH homolog OS=Guil... 30 0.060
sp|P51327|FTSH_PORPU Cell division protease ftsH homolog OS=Porp... 29 0.13
sp|Q1XDF9|FSTH_PORYE Cell division protease ftsH homolog OS=Porp... 29 0.13
sp|Q7TT47|SPG7_RAT Paraplegin OS=Rattus norvegicus GN=Spg7 PE=2 ... 34 0.26
sp|Q3ULF4|SPG7_MOUSE Paraplegin OS=Mus musculus GN=Spg7 PE=1 SV=1 34 0.26
sp|Q8JZQ2|AFG32_MOUSE AFG3-like protein 2 OS=Mus musculus GN=Afg... 34 0.26
sp|Q9Y4W6|AFG32_HUMAN AFG3-like protein 2 OS=Homo sapiens GN=AFG... 34 0.26
sp|Q2KJI7|AFG32_BOVIN AFG3-like protein 2 OS=Bos taurus GN=AFG3L... 34 0.26
sp|Q5Z974|FTSH1_ORYSJ Cell division protease ftsH homolog 1, chl... 28 0.27
sp|Q39444|FTSH_CAPAN Cell division protease ftsH homolog, chloro... 29 0.45
sp|Q55700|FTSH1_SYNY3 Cell division protease ftsH homolog 1 OS=S... 29 0.46
sp|O59824|YME1_SCHPO Protein YME1 homolog OS=Schizosaccharomyces... 33 0.58
sp|A2ZVG7|FTSH9_ORYSJ Cell division protease ftsH homolog 9, chl... 33 0.58
sp|Q39102|FTSH1_ARATH Cell division protease ftsH homolog 1, chl... 27 0.75
sp|Q9FH02|FTSH5_ARATH Cell division protease ftsH homolog 5, chl... 27 0.75
sp|P73179|FTSH2_SYNY3 Cell division protease ftsH homolog 2 OS=S... 30 0.75
sp|P46508|YME1_SCHMA Protein YME1 homolog OS=Schistosoma mansoni... 30 0.75
sp|Q9TJ83|FTSH_CYAME Cell division protease ftsH homolog OS=Cyan... 32 0.76
sp|Q9FGM0|FTSHB_ARATH Cell division protease ftsH homolog 11, ch... 32 1.3
sp|O88967|YMEL1_MOUSE ATP-dependent metalloprotease YME1L1 OS=Mu... 31 1.7
sp|Q96TA2|YMEL1_HUMAN ATP-dependent metalloprotease YME1L1 OS=Ho... 31 1.7
sp|Q655S1|FTSH2_ORYSJ Cell division protease ftsH homolog 2, chl... 28 2.1
sp|Q925S8|YMEL1_RAT ATP-dependent metalloprotease YME1L1 OS=Ratt... 31 2.2
sp|Q8LQJ8|FTSH5_ORYSJ Cell division protease ftsH homolog 5, mit... 31 2.2
sp|O80983|FTSH4_ARATH Cell division protease ftsH homolog 4, mit... 31 2.2
sp|Q6FP05|ATG2_CANGA Autophagy-related protein 2 OS=Candida glab... 31 2.2
sp|O82150|FTSH_TOBAC Cell division protease ftsH homolog, chloro... 27 2.6
sp|P37476|FTSH_BACSU Cell division protease ftsH homolog OS=Baci... 30 2.9
sp|O67077|FTSH_AQUAE Cell division protease ftsH homolog OS=Aqui... 30 2.9

>sp|P54813|YME1_CAEEL Protein YME1 homolog OS=Caenorhabditis elegans
GN=ymel-1 PE=2 SV=1
Length = 676

Score = 30.4 bits (67), Expect(2) = 0.028
Identities = 13/32 (40%), Positives = 20/32 (62%)
Frame = -1

Query: 124 KATFLKARPQLLHRLQVFLGGRAAEEALYGRD 29
K ++ + Q+L L V +GGR AEE ++G D
Sbjct: 500 KDSYQLTKAQMLATLDVMMGGRVAEELIFGDD 531



Score = 26.9 bits (58), Expect(2) = 0.028
Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 1/63 (1%)
Frame = -3

Query: 332 DRITVGPQRFGV-VRGLPVHRRMATLEVGLSMTTHILRRLEGAKLEYCERVSIVPRGETL 156
DR+ +GP R G + +R A E G H L L +V+I+PRG++L
Sbjct: 437 DRVLMGPARTGGRIPDEEANRNTAYHEAG-----HTLVSLYTKDATPLHKVTIIPRGQSL 491

Query: 155 SRT 147
T
Sbjct: 492 GHT 494


>sp|O78516|FTSH_GUITH Cell division protease ftsH homolog
OS=Guillardia theta GN=ftsH PE=3 SV=1
Length = 631

Score = 30.0 bits (66), Expect(2) = 0.060
Identities = 14/26 (53%), Positives = 19/26 (73%)
Frame = -1

Query: 112 LKARPQLLHRLQVFLGGRAAEEALYG 35
L +R Q+L R+ LGGRAAEE ++G
Sbjct: 476 LISRSQILARIMGALGGRAAEEVVFG 501



Score = 26.2 bits (56), Expect(2) = 0.060
Identities = 20/81 (24%), Positives = 38/81 (46%)
Frame = -3

Query: 335 VDRITVGPQRFGVVRGLPVHRRMATLEVGLSMTTHILRRLEGAKLEYCERVSIVPRGETL 156
+DR+ G + +V R +A EVG ++ +L+ + ++V++VPRG+
Sbjct: 410 IDRVIAGMEGKALVDS-KTKRLIAYHEVGHAIIGTLLKHHDPV-----QKVTLVPRGQAK 463

Query: 155 SRTIFQRLDDEGYFFESEATA 93
T F +D+ S+ A
Sbjct: 464 GLTWFTPSEDQSLISRSQILA 484


>sp|P51327|FTSH_PORPU Cell division protease ftsH homolog
OS=Porphyra purpurea GN=ftsH PE=3 SV=1
Length = 628

Score = 29.3 bits (64), Expect(2) = 0.13
Identities = 14/26 (53%), Positives = 19/26 (73%)
Frame = -1

Query: 112 LKARPQLLHRLQVFLGGRAAEEALYG 35
L +R Q+L R+ LGGRAAEE ++G
Sbjct: 476 LISRSQILARIVGALGGRAAEEIIFG 501



Score = 25.8 bits (55), Expect(2) = 0.13
Identities = 21/86 (24%), Positives = 38/86 (44%), Gaps = 5/86 (5%)
Frame = -3

Query: 335 VDRITVGPQRFGVVRGLPV-----HRRMATLEVGLSMTTHILRRLEGAKLEYCERVSIVP 171
+DR+ G + G P+ R +A EVG ++ +L + ++V+++P
Sbjct: 410 IDRVVAG------LEGTPLIDSKSKRLIAYHEVGHAIIGSLLEHHDPV-----QKVTLIP 458

Query: 170 RGETLSRTIFQRLDDEGYFFESEATA 93
RG+ T F DD+ S+ A
Sbjct: 459 RGQARGLTWFTPSDDQSLISRSQILA 484


>sp|Q1XDF9|FSTH_PORYE Cell division protease ftsH homolog
OS=Porphyra yezoensis GN=ftsH PE=3 SV=1
Length = 628

Score = 29.3 bits (64), Expect(2) = 0.13
Identities = 14/26 (53%), Positives = 19/26 (73%)
Frame = -1

Query: 112 LKARPQLLHRLQVFLGGRAAEEALYG 35
L +R Q+L R+ LGGRAAEE ++G
Sbjct: 476 LISRSQILARIVGALGGRAAEEIIFG 501



Score = 25.8 bits (55), Expect(2) = 0.13
Identities = 19/81 (23%), Positives = 37/81 (45%)
Frame = -3

Query: 335 VDRITVGPQRFGVVRGLPVHRRMATLEVGLSMTTHILRRLEGAKLEYCERVSIVPRGETL 156
+DR+ G + ++ R +A EVG ++ +L + ++V+++PRG+
Sbjct: 410 IDRVVAGMEGTPLIDSKS-KRLIAYHEVGHAIIGSLLEHHDPV-----QKVTLIPRGQAR 463

Query: 155 SRTIFQRLDDEGYFFESEATA 93
T F DD+ S+ A
Sbjct: 464 GLTWFTPSDDQSLISRSQILA 484


>sp|Q7TT47|SPG7_RAT Paraplegin OS=Rattus norvegicus GN=Spg7 PE=2
SV=1
Length = 744

Score = 33.9 bits (76), Expect = 0.26
Identities = 19/59 (32%), Positives = 32/59 (54%)
Frame = -1

Query: 199 NTASVYQLFLVARRSLVQFFSVWMMKATFLKARPQLLHRLQVFLGGRAAEEALYGRDTS 23
+T +V ++ + R + FS + + +L + QL R+ + LGGRAAE + R TS
Sbjct: 550 HTEAVMKVSIAPRTNAALGFSQMLPRDQYLFTKEQLFERMCMALGGRAAEAISFSRVTS 608


>sp|Q3ULF4|SPG7_MOUSE Paraplegin OS=Mus musculus GN=Spg7 PE=1 SV=1
Length = 781

Score = 33.9 bits (76), Expect = 0.26
Identities = 19/59 (32%), Positives = 32/59 (54%)
Frame = -1

Query: 199 NTASVYQLFLVARRSLVQFFSVWMMKATFLKARPQLLHRLQVFLGGRAAEEALYGRDTS 23
+T +V ++ + R + FS + + +L + QL R+ + LGGRAAE + R TS
Sbjct: 587 HTEAVMKVSIAPRTNAALGFSQMLPRDQYLFTKEQLFERMCMALGGRAAEAISFSRVTS 645


>sp|Q8JZQ2|AFG32_MOUSE AFG3-like protein 2 OS=Mus musculus GN=Afg3l2
PE=1 SV=1
Length = 802

Score = 33.9 bits (76), Expect = 0.26
Identities = 15/40 (37%), Positives = 26/40 (65%)
Frame = -1

Query: 142 FSVWMMKATFLKARPQLLHRLQVFLGGRAAEEALYGRDTS 23
++ ++ K +L + QLL R+ + LGGR +EE +GR T+
Sbjct: 604 YAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITT 643


>sp|Q9Y4W6|AFG32_HUMAN AFG3-like protein 2 OS=Homo sapiens GN=AFG3L2
PE=1 SV=2
Length = 797

Score = 33.9 bits (76), Expect = 0.26
Identities = 15/40 (37%), Positives = 26/40 (65%)
Frame = -1

Query: 142 FSVWMMKATFLKARPQLLHRLQVFLGGRAAEEALYGRDTS 23
++ ++ K +L + QLL R+ + LGGR +EE +GR T+
Sbjct: 605 YAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITT 644


>sp|Q2KJI7|AFG32_BOVIN AFG3-like protein 2 OS=Bos taurus GN=AFG3L2
PE=2 SV=1
Length = 805

Score = 33.9 bits (76), Expect = 0.26
Identities = 15/40 (37%), Positives = 26/40 (65%)
Frame = -1

Query: 142 FSVWMMKATFLKARPQLLHRLQVFLGGRAAEEALYGRDTS 23
++ ++ + +L R QLL R+ + LGGR +EE +GR T+
Sbjct: 606 YAQYLPREQYLYTREQLLDRMCMTLGGRVSEEIFFGRITT 645


>sp|Q5Z974|FTSH1_ORYSJ Cell division protease ftsH homolog 1,
chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH1
PE=2 SV=1
Length = 686

Score = 28.1 bits (61), Expect(2) = 0.27
Identities = 12/28 (42%), Positives = 20/28 (71%)
Frame = -1

Query: 112 LKARPQLLHRLQVFLGGRAAEEALYGRD 29
L +R L +++ V LGGR AEE ++G++
Sbjct: 539 LYSRSYLENQMAVALGGRVAEEVIFGQE 566



Score = 25.8 bits (55), Expect(2) = 0.27
Identities = 16/65 (24%), Positives = 30/65 (46%)
Frame = -3

Query: 335 VDRITVGPQRFGVVRGLPVHRRMATLEVGLSMTTHILRRLEGAKLEYCERVSIVPRGETL 156
++RI GP++ V R +A E G ++ ++ + ++SI+PRG+
Sbjct: 469 LERIIAGPEKKNAVVSEEKRRLVAYHEAGHALVGALMPEYDPVA-----KISIIPRGQAG 523

Query: 155 SRTIF 141
T F
Sbjct: 524 GLTFF 528


tr_hit_id A9RJ05
Definition tr|A9RJ05|A9RJ05_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 76
Score (bit) 100.0
E-value 2.0e-29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918822|Adiantum capillus-veneris mRNA, clone:
YMU001_000117_H01.
(337 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RJ05|A9RJ05_PHYPA Predicted protein OS=Physcomitrella paten... 100 2e-29
tr|A7PSH2|A7PSH2_VITVI Chromosome chr6 scaffold_28, whole genome... 96 8e-29
tr|A9SRQ7|A9SRQ7_PHYPA Predicted protein OS=Physcomitrella paten... 98 2e-28
tr|O22993|O22993_ARATH Cell division protein isolog (Cell divisi... 92 2e-26
tr|A8UWH5|A8UWH5_9AQUI Tryptophan synthase subunit beta OS=Hydro... 33 0.002
tr|B4U7U4|B4U7U4_HYDS0 ATP-dependent metalloprotease FtsH OS=Hyd... 32 0.005
tr|Q67JH0|Q67JH0_SYMTH Cell division protein OS=Symbiobacterium ... 30 0.067
tr|A8V262|A8V262_9AQUI Cell division protein FtsH OS=Hydrogenivi... 30 0.14
tr|B2V6K6|B2V6K6_SULSY ATP-dependent metalloprotease FtsH OS=Sul... 30 0.14
tr|B2J1P4|B2J1P4_NOSP7 ATP-dependent metalloprotease FtsH OS=Nos... 30 0.19
tr|Q10W04|Q10W04_TRIEI FtsH peptidase homologue, chloroplast. Me... 30 0.19
tr|Q1IWL5|Q1IWL5_DEIGD ATP-dependent metalloprotease FtsH OS=Dei... 30 0.19
tr|Q9RWT2|Q9RWT2_DEIRA Cell division protein FtsH OS=Deinococcus... 30 0.19
tr|Q9RYM2|Q9RYM2_DEIRA Cell division protein FtsH OS=Deinococcus... 29 0.24
tr|B1GZK7|B1GZK7_UNCTG Cell division protease FtsH OS=Uncultured... 29 0.24
tr|A6MW37|A6MW37_RHDSA Cell division protein OS=Rhodomonas salin... 30 0.24
tr|Q72IK4|Q72IK4_THET2 Cell division protein ftsH OS=Thermus the... 33 0.24
tr|Q5SI82|Q5SI82_THET8 Cell division protein FtsH OS=Thermus the... 33 0.24
tr|Q9LCZ4|Q9LCZ4_THETH FtsH OS=Thermus thermophilus GN=ftsH PE=1... 33 0.24
tr|A3IKL7|A3IKL7_9CHRO Cell division protein; FtsH OS=Cyanothece... 33 0.24
tr|A8XSL5|A8XSL5_CAEBR CBR-YMEL-1 protein (Fragment) OS=Caenorha... 30 0.31
tr|Q46L43|Q46L43_PROMT FtsH peptidase homologue, chloroplast. Me... 30 0.40
tr|A2C213|A2C213_PROM1 FtsH ATP-dependent protease-like protein ... 30 0.40
tr|Q5N4H9|Q5N4H9_SYNP6 ATP-dependent Zn protease OS=Synechococcu... 33 0.40
tr|Q31PP7|Q31PP7_SYNE7 FtsH peptidase homologue, chloroplast. Me... 33 0.40
tr|B5VXH2|B5VXH2_SPIMA ATP-dependent metalloprotease FtsH OS=Art... 29 0.40
tr|Q388P7|Q388P7_9TRYP Zinc metallopeptidase, putative OS=Trypan... 29 0.40
tr|B6G7Q4|B6G7Q4_9ACTN Putative uncharacterized protein (Fragmen... 37 0.50
tr|B1BAT1|B1BAT1_CLOBO Putative Cell division protease FtsH homo... 37 0.50
tr|Q311T4|Q311T4_DESDG FtsH peptidase. Metallo peptidase. MEROPS... 30 0.52

>tr|A9RJ05|A9RJ05_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_175333 PE=4 SV=1
Length = 958

Score = 100 bits (248), Expect(2) = 2e-29
Identities = 45/76 (59%), Positives = 61/76 (80%)
Frame = -3

Query: 335 VDRITVGPQRFGVVRGLPVHRRMATLEVGLSMTTHILRRLEGAKLEYCERVSIVPRGETL 156
+DR+T+GP+R G+ R LPVHRRMA E+G+++T+H+LR E A E+C+RVSIVPRG+TL
Sbjct: 664 LDRLTMGPERIGMRRRLPVHRRMAAHELGIALTSHLLRHFEQADTEFCDRVSIVPRGDTL 723

Query: 155 SRTIFQRLDDEGYFFE 108
+R I RL+DE Y FE
Sbjct: 724 ARCIMNRLEDEYYLFE 739



Score = 53.1 bits (126), Expect(2) = 2e-29
Identities = 24/34 (70%), Positives = 29/34 (85%)
Frame = -1

Query: 103 RPQLLHRLQVFLGGRAAEEALYGRDTSNWSVSAL 2
RP LLHRLQV LGGRA EE +YGRDTS++S++ L
Sbjct: 741 RPALLHRLQVLLGGRAGEEVMYGRDTSSYSLTHL 774


>tr|A7PSH2|A7PSH2_VITVI Chromosome chr6 scaffold_28, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00022916001
PE=4 SV=1
Length = 901

Score = 95.5 bits (236), Expect(2) = 8e-29
Identities = 43/76 (56%), Positives = 58/76 (76%)
Frame = -3

Query: 335 VDRITVGPQRFGVVRGLPVHRRMATLEVGLSMTTHILRRLEGAKLEYCERVSIVPRGETL 156
VDR+TVGP+R G+ G R AT EVG ++T+H+LRR E AK+E C+R+S++PRG+TL
Sbjct: 634 VDRLTVGPKRVGIELGHQGQCRRATTEVGTAITSHLLRRYESAKVERCDRISVIPRGQTL 693

Query: 155 SRTIFQRLDDEGYFFE 108
S+ +F RLDDE Y FE
Sbjct: 694 SQVVFDRLDDESYMFE 709



Score = 55.5 bits (132), Expect(2) = 8e-29
Identities = 27/34 (79%), Positives = 28/34 (82%)
Frame = -1

Query: 103 RPQLLHRLQVFLGGRAAEEALYGRDTSNWSVSAL 2
RPQLLHRLQV LGGRAAEE +YGRDTS SV L
Sbjct: 711 RPQLLHRLQVLLGGRAAEEVIYGRDTSRASVDYL 744


>tr|A9SRQ7|A9SRQ7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_187682 PE=4 SV=1
Length = 966

Score = 97.8 bits (242), Expect(2) = 2e-28
Identities = 43/76 (56%), Positives = 61/76 (80%)
Frame = -3

Query: 335 VDRITVGPQRFGVVRGLPVHRRMATLEVGLSMTTHILRRLEGAKLEYCERVSIVPRGETL 156
+DR+T+GP+R G+ R LPVHRRMA E+G+++T+H+LR E + E+C+RVSIVPRG+TL
Sbjct: 667 LDRLTMGPERIGMRRRLPVHRRMAAHELGIALTSHLLRHFEQSDTEFCDRVSIVPRGDTL 726

Query: 155 SRTIFQRLDDEGYFFE 108
+R I RL+DE Y F+
Sbjct: 727 ARCIMNRLEDEYYLFQ 742



Score = 52.0 bits (123), Expect(2) = 2e-28
Identities = 23/34 (67%), Positives = 29/34 (85%)
Frame = -1

Query: 103 RPQLLHRLQVFLGGRAAEEALYGRDTSNWSVSAL 2
+P LLHRLQV LGGRA EE +YGRDTS++S++ L
Sbjct: 744 KPALLHRLQVLLGGRAGEEVMYGRDTSSYSLTHL 777


>tr|O22993|O22993_ARATH Cell division protein isolog (Cell division
protein-like) OS=Arabidopsis thaliana GN=AT4g23940 PE=2
SV=1
Length = 946

Score = 91.7 bits (226), Expect(2) = 2e-26
Identities = 43/75 (57%), Positives = 56/75 (74%)
Frame = -3

Query: 335 VDRITVGPQRFGVVRGLPVHRRMATLEVGLSMTTHILRRLEGAKLEYCERVSIVPRGETL 156
VDR+TVGP R G+ G R AT EVG+++T+H+L R E AK+E C+RVSI+PRG+TL
Sbjct: 675 VDRLTVGPTRIGLELGHQGQCRRATTEVGVAITSHLLLRYENAKIERCDRVSIIPRGQTL 734

Query: 155 SRTIFQRLDDEGYFF 111
S+ +F RLDDE Y F
Sbjct: 735 SQVVFHRLDDESYMF 749



Score = 51.2 bits (121), Expect(2) = 2e-26
Identities = 25/33 (75%), Positives = 26/33 (78%)
Frame = -1

Query: 100 PQLLHRLQVFLGGRAAEEALYGRDTSNWSVSAL 2
PQLLHRLQV LGGRAAEE +YG DTS SV L
Sbjct: 753 PQLLHRLQVLLGGRAAEEVIYGSDTSKASVDYL 785


>tr|A8UWH5|A8UWH5_9AQUI Tryptophan synthase subunit beta
OS=Hydrogenivirga sp. 128-5-R1-1 GN=HG1285_14419 PE=4
SV=1
Length = 630

Score = 32.7 bits (73), Expect(2) = 0.002
Identities = 13/25 (52%), Positives = 18/25 (72%)
Frame = -1

Query: 103 RPQLLHRLQVFLGGRAAEEALYGRD 29
+ L +R+ V +GGRAAEE YG+D
Sbjct: 464 KKNLFNRILVMMGGRAAEEVFYGKD 488



Score = 32.0 bits (71), Expect(2) = 0.002
Identities = 23/71 (32%), Positives = 34/71 (47%)
Frame = -3

Query: 335 VDRITVGPQRFGVVRGLPVHRRMATLEVGLSMTTHILRRLEGAKLEYCERVSIVPRGETL 156
+DRIT+G +R G+V ++A E G H L + +VSI+PRG L
Sbjct: 394 IDRITMGLERKGMVISPKEKEKIAYHEAG-----HALMGFMTEDSDPVHKVSIIPRGMAL 448

Query: 155 SRTIFQRLDDE 123
T +DD+
Sbjct: 449 GVTQQLPIDDK 459


>tr|B4U7U4|B4U7U4_HYDS0 ATP-dependent metalloprotease FtsH
OS=Hydrogenobaculum sp. (strain Y04AAS1)
GN=HY04AAS1_0518 PE=4 SV=1
Length = 636

Score = 32.3 bits (72), Expect(2) = 0.005
Identities = 12/25 (48%), Positives = 17/25 (68%)
Frame = -1

Query: 103 RPQLLHRLQVFLGGRAAEEALYGRD 29
+ LL R+ + +GGR AEE YG+D
Sbjct: 470 KADLLSRIHILMGGRCAEEVFYGKD 494



Score = 31.2 bits (69), Expect(2) = 0.005
Identities = 21/78 (26%), Positives = 37/78 (47%)
Frame = -3

Query: 335 VDRITVGPQRFGVVRGLPVHRRMATLEVGLSMTTHILRRLEGAKLEYCERVSIVPRGETL 156
+DR+ +G +R G+ ++A E G H L L + +VSI+PRG L
Sbjct: 400 IDRVMMGLERRGMAISPKEKEKIAVHEAG-----HALMGLMMPDADPLHKVSIIPRGMAL 454

Query: 155 SRTIFQRLDDEGYFFESE 102
T +DD+ + +++
Sbjct: 455 GVTTQLPIDDKHIYDKAD 472


>tr|Q67JH0|Q67JH0_SYMTH Cell division protein OS=Symbiobacterium
thermophilum GN=ftsH3 PE=4 SV=1
Length = 626

Score = 30.0 bits (66), Expect(2) = 0.067
Identities = 13/28 (46%), Positives = 20/28 (71%)
Frame = -1

Query: 106 ARPQLLHRLQVFLGGRAAEEALYGRDTS 23
++ ++L R+ + LGGRAAEE +G TS
Sbjct: 464 SKSEILDRMTMALGGRAAEEITFGEITS 491



Score = 29.6 bits (65), Expect(2) = 0.067
Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 1/79 (1%)
Frame = -3

Query: 335 VDRITVG-PQRFGVVRGLPVHRRMATLEVGLSMTTHILRRLEGAKLEYCERVSIVPRGET 159
+DR+ G P++ V R A E G ++ H+L ++ +++I+PRG
Sbjct: 394 IDRVLAGGPEKKSRVISEKEKRVTAYHEAGHAVVGHMLPHMDPL-----HKITIIPRGRA 448

Query: 158 LSRTIFQRLDDEGYFFESE 102
+ T+F ++D +SE
Sbjct: 449 MGYTLFLPVEDRYNISKSE 467


>tr|A8V262|A8V262_9AQUI Cell division protein FtsH OS=Hydrogenivirga
sp. 128-5-R1-1 GN=HG1285_07739 PE=4 SV=1
Length = 628

Score = 30.4 bits (67), Expect(2) = 0.14
Identities = 13/28 (46%), Positives = 18/28 (64%)
Frame = -1

Query: 112 LKARPQLLHRLQVFLGGRAAEEALYGRD 29
L ++ L+ R+ GGRAAEE YG+D
Sbjct: 460 LYSKKDLMARILQLFGGRAAEEVFYGKD 487



Score = 28.1 bits (61), Expect(2) = 0.14
Identities = 22/81 (27%), Positives = 38/81 (46%)
Frame = -3

Query: 335 VDRITVGPQRFGVVRGLPVHRRMATLEVGLSMTTHILRRLEGAKLEYCERVSIVPRGETL 156
+DRI +G +R G+ ++A EVG H L + + + +VSI+PRG L
Sbjct: 393 MDRIMMGLERKGMAITPKEKEKIAYHEVG-----HALVGVMTKESDPLHKVSIIPRGMAL 447

Query: 155 SRTIFQRLDDEGYFFESEATA 93
T+ +D + + + A
Sbjct: 448 GITVNLPEEDRHLYSKKDLMA 468


>tr|B2V6K6|B2V6K6_SULSY ATP-dependent metalloprotease FtsH
OS=Sulfurihydrogenibium sp. (strain YO3AOP1)
GN=SYO3AOP1_0091 PE=4 SV=1
Length = 625

Score = 30.4 bits (67), Expect(2) = 0.14
Identities = 13/28 (46%), Positives = 18/28 (64%)
Frame = -1

Query: 112 LKARPQLLHRLQVFLGGRAAEEALYGRD 29
L ++ L+ R+ GGRAAEE YG+D
Sbjct: 453 LYSKKDLMARILQLFGGRAAEEVFYGKD 480



Score = 28.1 bits (61), Expect(2) = 0.14
Identities = 21/81 (25%), Positives = 39/81 (48%)
Frame = -3

Query: 335 VDRITVGPQRFGVVRGLPVHRRMATLEVGLSMTTHILRRLEGAKLEYCERVSIVPRGETL 156
+DRI +G +R G+ ++A EVG ++ +L + +VSI+PRG L
Sbjct: 386 LDRIMMGLERKGMAITEKEKEKIAYHEVGHAVVGVMLEEADPL-----HKVSIIPRGAAL 440

Query: 155 SRTIFQRLDDEGYFFESEATA 93
T+ +D+ + + + A
Sbjct: 441 GVTVNLPEEDKHLYSKKDLMA 461


>tr|B2J1P4|B2J1P4_NOSP7 ATP-dependent metalloprotease FtsH OS=Nostoc
punctiforme (strain ATCC 29133 / PCC 73102)
GN=Npun_F1740 PE=4 SV=1
Length = 642

Score = 30.4 bits (67), Expect(2) = 0.19
Identities = 14/27 (51%), Positives = 19/27 (70%)
Frame = -1

Query: 112 LKARPQLLHRLQVFLGGRAAEEALYGR 32
L +R QL R+ LGGRAAEE ++G+
Sbjct: 491 LVSRSQLKSRITATLGGRAAEEIVFGK 517



Score = 27.7 bits (60), Expect(2) = 0.19
Identities = 20/78 (25%), Positives = 39/78 (50%)
Frame = -3

Query: 335 VDRITVGPQRFGVVRGLPVHRRMATLEVGLSMTTHILRRLEGAKLEYCERVSIVPRGETL 156
VDR+ G + +V R +A EVG ++ +L+ + ++V+++PRG+ L
Sbjct: 425 VDRVVAGMEGTALVDSKS-KRLIAYHEVGHALVGTLLKDHDPV-----QKVTLIPRGQAL 478

Query: 155 SRTIFQRLDDEGYFFESE 102
T F +++G S+
Sbjct: 479 GLTWFTPNEEQGLVSRSQ 496