BP918840
Clone id YMU001_000118_B03
Library
Length 582
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000118_B03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TGCAAATATGCATCTCAGCTTGTGATGCAATTAATCTTTCAATATCCCTTTGTGCTCTAA
TTGAGCGGGTTAACAGTCCGTTTTGTGTGCTAAAGCTCCATAAGGGAGATACTCAACTCC
AATATCAACTTACTCCACTGCCATGGCAAGTAGCATCCACATGCAAGTAAATGTAAACAA
TCCATCTCAAGATTGTCTGGCCTTCTTTACTGTAAACAGCACCAAAATTTGTCACCATGA
AACGCGTTTCGGCAGATCCGAACAGGTGAAATGTGTCACTGATCAATTGAAACACACGCC
ATAGTTCCATAGTTTAAGTTTTTAGAGCCTTTCCAAATCCATAAGTGCCCGTCCGCATTC
CACATTAGACTGAAACGTTTTGAGGTGAAACACCGCTTTCAATAGTGAAATGCTGCGGCC
TTGAGACGTTTCGCAGTGATGCTGCCAGTGAGTAATTTTAATTTACAGCCGCTGCGGCTC
AGTTGATAGAATGTCCTATAGGGACCAAAGAAAAGACTCTGTAAAATAATATGCAAGCAT
AGTACAATACGCAGGAAAAATGTCTCCCTGCTTTATCTCATC
■■Homology search results ■■ -
sp_hit_id Q9BXB4
Definition sp|Q9BXB4|OSB11_HUMAN Oxysterol-binding protein-related protein 11 OS=Homo sapiens
Align length 42
Score (bit) 32.7
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918840|Adiantum capillus-veneris mRNA, clone:
YMU001_000118_B03.
(582 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9BXB4|OSB11_HUMAN Oxysterol-binding protein-related protein ... 33 1.3
sp|Q8CI95|OSB11_MOUSE Oxysterol-binding protein-related protein ... 32 2.3
sp|Q6PI53|MED24_XENLA Mediator of RNA polymerase II transcriptio... 30 6.7

>sp|Q9BXB4|OSB11_HUMAN Oxysterol-binding protein-related protein 11
OS=Homo sapiens GN=OSBPL11 PE=1 SV=2
Length = 747

Score = 32.7 bits (73), Expect = 1.3
Identities = 13/42 (30%), Positives = 27/42 (64%)
Frame = +2

Query: 104 GRYSTPISTYSTAMASSIHMQVNVNNPSQDCLAFFTVNSTKI 229
G+ + P+ + S ++ASS + ++ PSQ+ ++FF V +K+
Sbjct: 162 GKNNPPLKSRSFSLASSSNSPISQRRPSQNAISFFNVGHSKL 203


>sp|Q8CI95|OSB11_MOUSE Oxysterol-binding protein-related protein 11
OS=Mus musculus GN=Osbpl11 PE=1 SV=2
Length = 751

Score = 32.0 bits (71), Expect = 2.3
Identities = 13/42 (30%), Positives = 27/42 (64%)
Frame = +2

Query: 104 GRYSTPISTYSTAMASSIHMQVNVNNPSQDCLAFFTVNSTKI 229
G+ + P+ + S ++ASS + ++ PSQ+ ++FF V +K+
Sbjct: 167 GKNNPPLKSRSFSLASSGNSPISQRRPSQNAMSFFNVGHSKL 208


>sp|Q6PI53|MED24_XENLA Mediator of RNA polymerase II transcription
subunit 24 OS=Xenopus laevis GN=med24 PE=2 SV=1
Length = 988

Score = 30.4 bits (67), Expect = 6.7
Identities = 16/45 (35%), Positives = 24/45 (53%)
Frame = +1

Query: 79 RFVC*SSIREILNSNINLLHCHGK*HPHASKCKQSISRLSGLLYC 213
R +C S+ EI++ + L CHGK C+ +S L+ LL C
Sbjct: 90 RDLCIQSLLEIMDMFCDNLSCHGKAEECIGLCRALMSALNWLLRC 134


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918840|Adiantum capillus-veneris mRNA, clone:
YMU001_000118_B03.
(582 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******