BP918869
Clone id YMU001_000118_E01
Library
Length 512
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000118_E01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GACACACAAGAGAGTGATGAGAAAACTCTTCTAAGCAGGCAAACTTGATTCTGAAATCAA
TTAAGGCAGAAGGCATTGACATCTTACCATTCCAGACAGCTTTGGTGTTCCCCAAGAATG
CACGCAAGTAAACTTGTCTTCCCAGCCCCTACTTTTCCACAGACAGACACCCGCATACCC
TTGCTTACTCTCAGATTGATGTTTGAGAGTGTCGGCATCATGCCAGAAGATGGGTCCCAG
CTGAAAGTACCATCTCTGATCTCCACTGCCATTTCAGAGGTACTCTTGCTTATCTTACAA
ACTGCATCTTTTGGCAGCTCTTCCTCCTCCAGAAAACTTGAAATTCGATCCAAGGACACT
TTGGTTTGTGCAATCATTGCCACCAGGTCTGGAAAGCTTCGCAAAGGTTCTTGCAAGATA
CGGAACGTGGCAAGTGCTGACAGGACACGTCCTGCAGTGAGTGGAATACCAAGTAAAACA
CAGGTGCCAAAAGTTACTACAGAAACGAAAAC
■■Homology search results ■■ -
sp_hit_id Q7GB25
Definition sp|Q7GB25|MRP5_ARATH Multidrug resistance-associated protein 5 OS=Arabidopsis thaliana
Align length 135
Score (bit) 177.0
E-value 3.0e-44
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918869|Adiantum capillus-veneris mRNA, clone:
YMU001_000118_E01.
(512 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q7GB25|MRP5_ARATH Multidrug resistance-associated protein 5 O... 177 3e-44
sp|Q8VZZ4|MRP8_ARATH Multidrug resistance-associated protein 8 O... 153 4e-37
sp|Q9M1C7|MRP9_ARATH Multidrug resistance-associated protein 9 O... 153 5e-37
sp|Q9LK64|MRP3_ARATH Multidrug resistance-associated protein 3 O... 153 5e-37
sp|Q7FB56|MRP15_ARATH Putative multidrug resistance-associated p... 147 3e-35
sp|Q9LK62|MRP7_ARATH Multidrug resistance-associated protein 7 O... 144 3e-34
sp|Q7DM58|MRP4_ARATH Multidrug resistance-associated protein 4 O... 120 5e-27
sp|Q9LYS2|MRP14_ARATH Multidrug resistance-associated protein 14... 116 5e-26
sp|Q9LZJ5|MRP10_ARATH Multidrug resistance-associated protein 10... 115 2e-25
sp|Q8LGU1|MRP6_ARATH Multidrug resistance-associated protein 6 O... 112 1e-24
sp|Q42093|MRP2_ARATH Multidrug resistance-associated protein 2 O... 100 3e-21
sp|Q9C8G9|MRP1_ARATH Multidrug resistance-associated protein 1 O... 96 1e-19
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 O... 94 3e-19
sp|Q9C8H0|MRP13_ARATH Multidrug resistance-associated protein 13... 94 3e-19
sp|Q9C8H1|MRP12_ARATH Multidrug resistance-associated protein 12... 93 8e-19
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 O... 92 1e-18
sp|O88563|MRP3_RAT Canalicular multispecific organic anion trans... 92 1e-18
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dicty... 86 1e-16
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion tra... 86 1e-16
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion trans... 86 1e-16
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 O... 84 3e-16
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion tra... 84 4e-16
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion tra... 82 1e-15
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 O... 80 6e-15
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Sc... 80 6e-15
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion tra... 79 9e-15
sp|Q9P5N0|YH85_SCHPO Uncharacterized ABC transporter ATP-binding... 79 2e-14
sp|Q9SKX0|MRP11_ARATH Multidrug resistance-associated protein 11... 78 2e-14
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomy... 77 5e-14
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 O... 77 5e-14

>sp|Q7GB25|MRP5_ARATH Multidrug resistance-associated protein 5
OS=Arabidopsis thaliana GN=MRP5 PE=2 SV=2
Length = 1514

Score = 177 bits (449), Expect = 3e-44
Identities = 89/135 (65%), Positives = 108/135 (80%)
Frame = -1

Query: 512 VFVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSF 333
+FV+ VTF T + LG LTAG VLSALATFRILQEPLR+FPDLV+M+AQTKVSLDRIS F
Sbjct: 540 IFVAAVTFATSIFLGTQLTAGGVLSALATFRILQEPLRNFPDLVSMMAQTKVSLDRISGF 599

Query: 332 LEEEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGK 153
L+EEEL +DA I + S +A+EI+DG F WDP S PTLS I ++V KGMRV+VCG
Sbjct: 600 LQEEELQEDATVVIPRGLSNIAIEIKDGVFCWDPFSS-RPTLSGIQMKVEKGMRVAVCGT 658

Query: 152 VGAGKTSLLACILGE 108
VG+GK+S ++CILGE
Sbjct: 659 VGSGKSSFISCILGE 673


>sp|Q8VZZ4|MRP8_ARATH Multidrug resistance-associated protein 8
OS=Arabidopsis thaliana GN=MRP8 PE=2 SV=2
Length = 1466

Score = 153 bits (387), Expect = 4e-37
Identities = 76/134 (56%), Positives = 105/134 (78%)
Frame = -1

Query: 509 FVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSFL 330
F+S FG C+LL IPL +G++L+ALATFRILQ P+ P+ ++MI QTKVSL+RI+SFL
Sbjct: 520 FISATAFGACLLLKIPLESGKILAALATFRILQGPIYKLPETISMIVQTKVSLNRIASFL 579

Query: 329 EEEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGKV 150
++L +D V ++ +SEMAVEI +GTFSWD SS +PTL ++N +VS+GM V++CG V
Sbjct: 580 CLDDLQQDVVGRLPSGSSEMAVEISNGTFSWDDSS-PIPTLRDMNFKVSQGMNVAICGTV 638

Query: 149 GAGKTSLLACILGE 108
G+GK+SLL+ ILGE
Sbjct: 639 GSGKSSLLSSILGE 652


>sp|Q9M1C7|MRP9_ARATH Multidrug resistance-associated protein 9
OS=Arabidopsis thaliana GN=MRP9 PE=2 SV=1
Length = 1490

Score = 153 bits (386), Expect = 5e-37
Identities = 77/135 (57%), Positives = 104/135 (77%)
Frame = -1

Query: 506 VSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSFLE 327
+SVVTF TC+L+G+ LTAG VLSALATF++LQ P+ PDL++ + Q+KVS DRI+S+L+
Sbjct: 550 ISVVTFVTCMLMGVKLTAGAVLSALATFQMLQSPIFGLPDLLSALVQSKVSADRIASYLQ 609

Query: 326 EEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGKVG 147
+ E KDAV SK +E++VEI +G FSW+P S PTL +I L+V GM+V+VCG VG
Sbjct: 610 QSETQKDAVEYCSKDHTELSVEIENGAFSWEPESS-RPTLDDIELKVKSGMKVAVCGAVG 668

Query: 146 AGKTSLLACILGEHQ 102
+GK+SLL+ ILGE Q
Sbjct: 669 SGKSSLLSSILGEIQ 683


>sp|Q9LK64|MRP3_ARATH Multidrug resistance-associated protein 3
OS=Arabidopsis thaliana GN=MRP3 PE=1 SV=1
Length = 1514

Score = 153 bits (386), Expect = 5e-37
Identities = 77/133 (57%), Positives = 104/133 (78%)
Frame = -1

Query: 506 VSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSFLE 327
VSV TFG C+LLGIPL +G++LSALATFRILQEP+ + PD ++MI QTKVSLDR++S+L
Sbjct: 560 VSVSTFGACILLGIPLESGKILSALATFRILQEPIYNLPDTISMIVQTKVSLDRLASYLC 619

Query: 326 EEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGKVG 147
+ L D V ++ K +S++AVE+ + T SWD SS PTL +IN +V GM+V+VCG VG
Sbjct: 620 LDNLQPDIVERLPKGSSDVAVEVINSTLSWDVSSS-NPTLKDINFKVFPGMKVAVCGTVG 678

Query: 146 AGKTSLLACILGE 108
+GK+SLL+ +LGE
Sbjct: 679 SGKSSLLSSLLGE 691



Score = 29.6 bits (65), Expect = 8.5
Identities = 22/84 (26%), Positives = 40/84 (47%), Gaps = 6/84 (7%)
Frame = -1

Query: 359 VSLDRISSFLEEEELPKDAVCKISKSTSEMA------VEIRDGTFSWDPSSGMMPTLSNI 198
+S++RI L+ +P + I + E + VEIRD + P ++ L I
Sbjct: 1235 ISVERI---LQYASVPSEPPLVIESNRPEQSWPSRGEVEIRDLQVRYAPHMPLV--LRGI 1289

Query: 197 NLRVSKGMRVSVCGKVGAGKTSLL 126
G+R + G+ G+GK++L+
Sbjct: 1290 TCTFKGGLRTGIVGRTGSGKSTLI 1313


>sp|Q7FB56|MRP15_ARATH Putative multidrug resistance-associated
protein 15 OS=Arabidopsis thaliana GN=MRP15 PE=5 SV=1
Length = 1037

Score = 147 bits (371), Expect = 3e-35
Identities = 74/135 (54%), Positives = 101/135 (74%)
Frame = -1

Query: 506 VSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSFLE 327
+SVVTF TC+L+G+ LTAG VLSALATF++LQ P+ PDL++ + Q+KVS DRI+S+L+
Sbjct: 134 ISVVTFVTCMLMGVKLTAGAVLSALATFQMLQSPIFGLPDLLSALVQSKVSADRIASYLQ 193

Query: 326 EEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGKVG 147
+ E KDAV S +E +VEI +G FSW+P S PTL +I L+V GM+V++CG VG
Sbjct: 194 QSETQKDAVEYCSNDHTEFSVEIENGAFSWEPESS-RPTLDDIELKVKSGMKVAICGAVG 252

Query: 146 AGKTSLLACILGEHQ 102
+GK+SL + ILGE Q
Sbjct: 253 SGKSSLPSSILGEIQ 267


>sp|Q9LK62|MRP7_ARATH Multidrug resistance-associated protein 7
OS=Arabidopsis thaliana GN=MRP7 PE=2 SV=1
Length = 1493

Score = 144 bits (362), Expect = 3e-34
Identities = 69/134 (51%), Positives = 100/134 (74%)
Frame = -1

Query: 509 FVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSFL 330
FVS FG C+LL IPL +G++++ALATFRILQ P+ PD ++MI QTKVSLDRI++FL
Sbjct: 543 FVSATAFGACMLLKIPLESGKIIAALATFRILQTPIYKLPDTISMIVQTKVSLDRIATFL 602

Query: 329 EEEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGKV 150
++L +D + ++ +S+M VE+ +G FSWD SS +PTL +I ++ GM +++CG V
Sbjct: 603 CLDDLQQDGMERLPSGSSKMDVEVSNGAFSWDDSS-PIPTLKDIRFKIPHGMNIAICGTV 661

Query: 149 GAGKTSLLACILGE 108
G+GK+SLL+ ILGE
Sbjct: 662 GSGKSSLLSSILGE 675


>sp|Q7DM58|MRP4_ARATH Multidrug resistance-associated protein 4
OS=Arabidopsis thaliana GN=MRP4 PE=1 SV=2
Length = 1516

Score = 120 bits (300), Expect = 5e-27
Identities = 60/135 (44%), Positives = 87/135 (64%)
Frame = -1

Query: 512 VFVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSF 333
V +S +TF T + LG+ L AG V + F+ILQEP+R+FP + ++Q +SL R+ S+
Sbjct: 559 VLISALTFATALALGVKLDAGTVFTTTTIFKILQEPIRTFPQSMISLSQAMISLGRLDSY 618

Query: 332 LEEEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGK 153
+ +EL +DAV + AVE+RDG+FSWD P LS+IN +V KG ++ G
Sbjct: 619 MMSKELSEDAVERALGCDGNTAVEVRDGSFSWDDEDN-EPALSDINFKVKKGELTAIVGT 677

Query: 152 VGAGKTSLLACILGE 108
VG+GK+SLLA +LGE
Sbjct: 678 VGSGKSSLLASVLGE 692


>sp|Q9LYS2|MRP14_ARATH Multidrug resistance-associated protein 14
OS=Arabidopsis thaliana GN=MRP14 PE=2 SV=1
Length = 1389

Score = 116 bits (291), Expect = 5e-26
Identities = 59/136 (43%), Positives = 87/136 (63%), Gaps = 1/136 (0%)
Frame = -1

Query: 512 VFVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSF 333
VFVS TF TC L IPL A V + +AT R++Q+P+R PD++ + Q KV+ RI++F
Sbjct: 454 VFVSAATFATCYFLDIPLRASNVFTFVATLRLVQDPVRMIPDVIGVTIQAKVAFSRIATF 513

Query: 332 LEEEELPKDAVCKISKST-SEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCG 156
LE EL + +S ++ A+ I+ +FSW+ P L N++L V G +V+VCG
Sbjct: 514 LEAPELQGGERRRKQRSEGNQNAIIIKSASFSWEEKGSTKPNLRNVSLEVKFGEKVAVCG 573

Query: 155 KVGAGKTSLLACILGE 108
+VG+GK++LLA ILGE
Sbjct: 574 EVGSGKSTLLAAILGE 589


>sp|Q9LZJ5|MRP10_ARATH Multidrug resistance-associated protein 10
OS=Arabidopsis thaliana GN=MRP10 PE=1 SV=1
Length = 1539

Score = 115 bits (287), Expect = 2e-25
Identities = 57/135 (42%), Positives = 84/135 (62%)
Frame = -1

Query: 512 VFVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSF 333
V +S +TF T V LG+ L AG V + F+ILQEP+R+FP + ++Q +SL R+ ++
Sbjct: 557 VLISALTFTTAVFLGVKLDAGTVFTTTTIFKILQEPIRTFPQSMISLSQAMISLGRLDAY 616

Query: 332 LEEEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGK 153
+ EL ++ V + +AVEI+DG+FSWD P + NIN V KG ++ G
Sbjct: 617 MMSRELSEETVERSQGCDGNVAVEIKDGSFSWDDEDD-EPAIENINFEVKKGELAAIVGT 675

Query: 152 VGAGKTSLLACILGE 108
VG+GK+SLLA +LGE
Sbjct: 676 VGSGKSSLLASVLGE 690


>sp|Q8LGU1|MRP6_ARATH Multidrug resistance-associated protein 6
OS=Arabidopsis thaliana GN=MRP6 PE=2 SV=2
Length = 1295

Score = 112 bits (280), Expect = 1e-24
Identities = 56/132 (42%), Positives = 83/132 (62%)
Frame = -1

Query: 503 SVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSFLEE 324
SVV G +L PL A + + LAT R++ EP++ PD ++ I Q VS R+++FL +
Sbjct: 360 SVVFLGCALLKSAPLNASTIFTVLATLRVMSEPVKIIPDAISAIIQGNVSFQRLNNFLLD 419

Query: 323 EELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGKVGA 144
+EL D + + S AV+I+ G F W+P + +PTL NI+L + G +V+VCG VGA
Sbjct: 420 DELKMDEIERSGLDASGTAVDIQVGNFGWEPET-KIPTLRNIHLEIKHGQKVAVCGPVGA 478

Query: 143 GKTSLLACILGE 108
GK+SLL +LGE
Sbjct: 479 GKSSLLHAVLGE 490


tr_hit_id A7KVC2
Definition tr|A7KVC2|A7KVC2_MAIZE Low phytic acid 1 OS=Zea mays
Align length 135
Score (bit) 179.0
E-value 5.0e-44
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918869|Adiantum capillus-veneris mRNA, clone:
YMU001_000118_E01.
(512 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7KVC2|A7KVC2_MAIZE Low phytic acid 1 OS=Zea mays GN=lpa1 PE=... 179 5e-44
tr|Q10RX7|Q10RX7_ORYSJ Os03g0142800 protein OS=Oryza sativa subs... 179 7e-44
tr|A3ADZ9|A3ADZ9_ORYSJ Putative uncharacterized protein OS=Oryza... 179 7e-44
tr|A2XCD4|A2XCD4_ORYSI Putative uncharacterized protein OS=Oryza... 179 7e-44
tr|Q0WNH8|Q0WNH8_ARATH Multi-drug resistance protein OS=Arabidop... 177 3e-43
tr|A7Q1J8|A7Q1J8_VITVI Chromosome chr7 scaffold_44, whole genome... 174 2e-42
tr|A5BZY6|A5BZY6_VITVI Putative uncharacterized protein OS=Vitis... 172 1e-41
tr|A7Q934|A7Q934_VITVI Chromosome chr19 scaffold_66, whole genom... 171 2e-41
tr|A7Q947|A7Q947_VITVI Chromosome chr19 scaffold_66, whole genom... 171 3e-41
tr|Q8GU61|Q8GU61_ORYSJ MRP-like ABC transporter OS=Oryza sativa ... 169 7e-41
tr|Q6K8A7|Q6K8A7_ORYSJ Putative MRP-like ABC transporter OS=Oryz... 169 7e-41
tr|Q0E1Z1|Q0E1Z1_ORYSJ Os02g0288400 protein OS=Oryza sativa subs... 169 7e-41
tr|B8AFP1|B8AFP1_ORYSI Putative uncharacterized protein OS=Oryza... 169 7e-41
tr|A7R7W8|A7R7W8_VITVI Chromosome undetermined scaffold_2072, wh... 169 7e-41
tr|A5C6D4|A5C6D4_VITVI Putative uncharacterized protein OS=Vitis... 169 7e-41
tr|Q94E55|Q94E55_ORYSJ Putative MRP-like ABC transporter OS=Oryz... 169 1e-40
tr|Q0JQA5|Q0JQA5_ORYSJ Os01g0173900 protein OS=Oryza sativa subs... 169 1e-40
tr|A2ZPT4|A2ZPT4_ORYSJ Putative uncharacterized protein OS=Oryza... 169 1e-40
tr|A2WL88|A2WL88_ORYSI Putative uncharacterized protein OS=Oryza... 169 1e-40
tr|A2X3K4|A2X3K4_ORYSI Putative uncharacterized protein OS=Oryza... 167 4e-40
tr|Q8GU60|Q8GU60_ORYSJ MRP-like ABC transporter OS=Oryza sativa ... 166 8e-40
tr|Q6K8A2|Q6K8A2_ORYSJ Putative MRP-like ABC transporter OS=Oryz... 166 8e-40
tr|Q0E1Y9|Q0E1Y9_ORYSJ Os02g0288700 protein OS=Oryza sativa subs... 166 8e-40
tr|A7PK05|A7PK05_VITVI Chromosome chr15 scaffold_19, whole genom... 163 5e-39
tr|Q71CZ3|Q71CZ3_WHEAT Multidrug resistance associated protein M... 161 2e-38
tr|B0KYV2|B0KYV2_GOSBA MRP-like ABC transporter protein (Fragmen... 158 1e-37
tr|A9TW55|A9TW55_PHYPA ATP-binding cassette transporter, subfami... 157 2e-37
tr|Q6Y3H9|Q6Y3H9_MAIZE Multidrug resistance associated protein 2... 156 5e-37
tr|A9U4I9|A9U4I9_PHYPA ATP-binding cassette transporter, subfami... 156 6e-37
tr|A9TG36|A9TG36_PHYPA ATP-binding cassette transporter, subfami... 154 2e-36

>tr|A7KVC2|A7KVC2_MAIZE Low phytic acid 1 OS=Zea mays GN=lpa1 PE=2
SV=1
Length = 1510

Score = 179 bits (455), Expect = 5e-44
Identities = 87/135 (64%), Positives = 117/135 (86%)
Frame = -1

Query: 512 VFVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSF 333
+FV+V+TFGTC+LLG LTAG VLSALATFRILQEPLR+FPDL++M+AQT+VSLDR+S F
Sbjct: 547 IFVAVITFGTCILLGGQLTAGGVLSALATFRILQEPLRNFPDLISMMAQTRVSLDRLSHF 606

Query: 332 LEEEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGK 153
L++EELP DA + +S+++ AV+I+DG FSW+P + + PTLS+I+L V +GMRV+VCG
Sbjct: 607 LQQEELPDDATINVPQSSTDKAVDIKDGAFSWNPYT-LTPTLSDIHLSVVRGMRVAVCGV 665

Query: 152 VGAGKTSLLACILGE 108
+G+GK+SLL+ ILGE
Sbjct: 666 IGSGKSSLLSSILGE 680


>tr|Q10RX7|Q10RX7_ORYSJ Os03g0142800 protein OS=Oryza sativa subsp.
japonica GN=Os03g0142800 PE=3 SV=1
Length = 1505

Score = 179 bits (454), Expect = 7e-44
Identities = 89/135 (65%), Positives = 112/135 (82%)
Frame = -1

Query: 512 VFVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSF 333
+FV+V+TFGTC+LLG LTAG VLSALATFRILQEPLR+FPDL++MIAQT+VSLDR+S F
Sbjct: 541 IFVAVITFGTCILLGGELTAGGVLSALATFRILQEPLRNFPDLISMIAQTRVSLDRLSHF 600

Query: 332 LEEEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGK 153
L++EELP DA + +++ A+ I D TFSW+PSS PTLS INL V +GMRV+VCG
Sbjct: 601 LQQEELPDDATITVPHGSTDKAININDATFSWNPSS-PTPTLSGINLSVVRGMRVAVCGV 659

Query: 152 VGAGKTSLLACILGE 108
+G+GK+SLL+ ILGE
Sbjct: 660 IGSGKSSLLSSILGE 674


>tr|A3ADZ9|A3ADZ9_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_009021 PE=3 SV=1
Length = 1480

Score = 179 bits (454), Expect = 7e-44
Identities = 89/135 (65%), Positives = 112/135 (82%)
Frame = -1

Query: 512 VFVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSF 333
+FV+V+TFGTC+LLG LTAG VLSALATFRILQEPLR+FPDL++MIAQT+VSLDR+S F
Sbjct: 516 IFVAVITFGTCILLGGELTAGGVLSALATFRILQEPLRNFPDLISMIAQTRVSLDRLSHF 575

Query: 332 LEEEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGK 153
L++EELP DA + +++ A+ I D TFSW+PSS PTLS INL V +GMRV+VCG
Sbjct: 576 LQQEELPDDATITVPHGSTDKAININDATFSWNPSS-PTPTLSGINLSVVRGMRVAVCGV 634

Query: 152 VGAGKTSLLACILGE 108
+G+GK+SLL+ ILGE
Sbjct: 635 IGSGKSSLLSSILGE 649


>tr|A2XCD4|A2XCD4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_09965 PE=3 SV=1
Length = 1505

Score = 179 bits (454), Expect = 7e-44
Identities = 89/135 (65%), Positives = 112/135 (82%)
Frame = -1

Query: 512 VFVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSF 333
+FV+V+TFGTC+LLG LTAG VLSALATFRILQEPLR+FPDL++MIAQT+VSLDR+S F
Sbjct: 541 IFVAVITFGTCILLGGELTAGGVLSALATFRILQEPLRNFPDLISMIAQTRVSLDRLSHF 600

Query: 332 LEEEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGK 153
L++EELP DA + +++ A+ I D TFSW+PSS PTLS INL V +GMRV+VCG
Sbjct: 601 LQQEELPDDATITVPHGSTDKAININDATFSWNPSS-PTPTLSGINLSVVRGMRVAVCGV 659

Query: 152 VGAGKTSLLACILGE 108
+G+GK+SLL+ ILGE
Sbjct: 660 IGSGKSSLLSSILGE 674


>tr|Q0WNH8|Q0WNH8_ARATH Multi-drug resistance protein OS=Arabidopsis
thaliana GN=At1g04120 PE=2 SV=1
Length = 820

Score = 177 bits (449), Expect = 3e-43
Identities = 89/135 (65%), Positives = 108/135 (80%)
Frame = -1

Query: 512 VFVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSF 333
+FV+ VTF T + LG LTAG VLSALATFRILQEPLR+FPDLV+M+AQTKVSLDRIS F
Sbjct: 540 IFVAAVTFATSIFLGTQLTAGGVLSALATFRILQEPLRNFPDLVSMMAQTKVSLDRISGF 599

Query: 332 LEEEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGK 153
L+EEEL +DA I + S +A+EI+DG F WDP S PTLS I ++V KGMRV+VCG
Sbjct: 600 LQEEELQEDATVVIPRGLSNIAIEIKDGVFCWDPFSS-RPTLSGIQMKVEKGMRVAVCGT 658

Query: 152 VGAGKTSLLACILGE 108
VG+GK+S ++CILGE
Sbjct: 659 VGSGKSSFISCILGE 673


>tr|A7Q1J8|A7Q1J8_VITVI Chromosome chr7 scaffold_44, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00028494001
PE=3 SV=1
Length = 1532

Score = 174 bits (442), Expect = 2e-42
Identities = 86/135 (63%), Positives = 110/135 (81%)
Frame = -1

Query: 512 VFVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSF 333
+FV+ +TFGT +LLG LTAG VLSALATFRILQEPLR+FPDLV+M+AQTKVSLDRIS F
Sbjct: 561 IFVAAITFGTSILLGTQLTAGGVLSALATFRILQEPLRNFPDLVSMMAQTKVSLDRISGF 620

Query: 332 LEEEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGK 153
L+EEEL +DA + + + MA+EI++G F WDP+S + TLS I ++V +G RV+VCG
Sbjct: 621 LQEEELQEDATIVLPRGITNMAIEIKNGEFCWDPTSSKL-TLSGIQMKVERGRRVAVCGM 679

Query: 152 VGAGKTSLLACILGE 108
VG+GK+S L+CILGE
Sbjct: 680 VGSGKSSFLSCILGE 694


>tr|A5BZY6|A5BZY6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_025297 PE=3 SV=1
Length = 1428

Score = 172 bits (435), Expect = 1e-41
Identities = 86/134 (64%), Positives = 111/134 (82%)
Frame = -1

Query: 509 FVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSFL 330
FVSVVTFGTC+LLGIPL +G++LS++ATFRILQ+P+ PDL++ IAQTKVSLDRI+SFL
Sbjct: 492 FVSVVTFGTCMLLGIPLESGKILSSIATFRILQQPIYHLPDLISAIAQTKVSLDRIASFL 551

Query: 329 EEEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGKV 150
++L D + ++ K +S+ A+EI DG FSWD SS PTL +INLRV +GMRVSVCG V
Sbjct: 552 CLDDLQSDVIERLPKGSSDTAIEIVDGNFSWDLSS-PNPTLKDINLRVCRGMRVSVCGTV 610

Query: 149 GAGKTSLLACILGE 108
G+GK+SLL+C+LGE
Sbjct: 611 GSGKSSLLSCMLGE 624


>tr|A7Q934|A7Q934_VITVI Chromosome chr19 scaffold_66, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00033319001
PE=3 SV=1
Length = 999

Score = 171 bits (433), Expect = 2e-41
Identities = 85/134 (63%), Positives = 110/134 (82%)
Frame = -1

Query: 509 FVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSFL 330
FVSVVTFGTC+L+GIPL +G++LS+LATFRILQ+P+ PDL++MI QTKVSLDRI+SFL
Sbjct: 38 FVSVVTFGTCMLIGIPLESGKILSSLATFRILQQPIYLLPDLISMIVQTKVSLDRITSFL 97

Query: 329 EEEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGKV 150
+L D + ++ K +S+ A+EI DG FSWD SS PTL +INLRV +GMRV+VCG V
Sbjct: 98 RLVDLQSDVIERLPKGSSDTAIEIVDGNFSWDLSS-PNPTLKDINLRVCRGMRVAVCGTV 156

Query: 149 GAGKTSLLACILGE 108
G+GK+SLL+C+LGE
Sbjct: 157 GSGKSSLLSCMLGE 170


>tr|A7Q947|A7Q947_VITVI Chromosome chr19 scaffold_66, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00033332001
PE=3 SV=1
Length = 1137

Score = 171 bits (432), Expect = 3e-41
Identities = 85/134 (63%), Positives = 111/134 (82%)
Frame = -1

Query: 509 FVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSFL 330
FVSVVTFGTC+LLGIPL +G++LS++ATFRILQ+P+ PDL++ IAQTKVSLDRI+SFL
Sbjct: 192 FVSVVTFGTCMLLGIPLESGKILSSIATFRILQQPIYHLPDLISAIAQTKVSLDRIASFL 251

Query: 329 EEEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGKV 150
++L D + ++ K +S+ A+EI DG FSWD SS PTL +INLRV +GMRV+VCG V
Sbjct: 252 CLDDLQSDVIERLPKGSSDTAIEIVDGNFSWDLSS-PNPTLKDINLRVCRGMRVAVCGTV 310

Query: 149 GAGKTSLLACILGE 108
G+GK+SLL+C+LGE
Sbjct: 311 GSGKSSLLSCMLGE 324


>tr|Q8GU61|Q8GU61_ORYSJ MRP-like ABC transporter OS=Oryza sativa
subsp. japonica GN=mrp5 PE=3 SV=1
Length = 1357

Score = 169 bits (428), Expect = 7e-41
Identities = 81/134 (60%), Positives = 109/134 (81%)
Frame = -1

Query: 509 FVSVVTFGTCVLLGIPLTAGRVLSALATFRILQEPLRSFPDLVAMIAQTKVSLDRISSFL 330
F+++VTFGTC+LLGIPL G+VLSALATFR LQ P+ S PD V++I QTKVSLDRI SF+
Sbjct: 410 FIAMVTFGTCLLLGIPLETGKVLSALATFRQLQGPINSIPDTVSVIIQTKVSLDRICSFM 469

Query: 329 EEEELPKDAVCKISKSTSEMAVEIRDGTFSWDPSSGMMPTLSNINLRVSKGMRVSVCGKV 150
EEL D V K+ + T+++++E+R+G FSW+ SS +PTL N+N R+ +GMRV++CG V
Sbjct: 470 HLEELSSDVVTKLPRGTTDVSIEVRNGQFSWNTSS-EVPTLRNLNFRIRQGMRVAICGTV 528

Query: 149 GAGKTSLLACILGE 108
G+GK+SLL+CILGE
Sbjct: 529 GSGKSSLLSCILGE 542