BP918873
Clone id YMU001_000118_E05
Library
Length 541
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000118_E05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GGATATTGCTATAGATGTCGCACATGCTTTAACTTATCTCCACCTTTATGCAGATAAGTC
CATTATACATCGAGACATCAAGTCCTCAAATATACTTCTGACTGAAAACTTCCGAGCAAA
AGTAGCGGACTTTGGATTTTCGCGTCTCGGTCCCACAGACTTTGATGCAACTCATGTATC
TACGCAAGTGAAAGGGACCGCAGGATATCTTGACCCAGAGTATCTGAAAACATATCAACT
GACTCAGAAAAGTGATGTGTACTCTTATGGCGTCCTTCTCGTGGAATTATTTTCAGCTAG
ACGGCCAATTGAGCAGAAACGGGAATCAAAAGAGAGGGTAACAACAAGATGGGCATTCCA
GATGTTCAATGATGGAAAAGGGATAGAAGTGCTGGACCCAAAGATAGAGAGAACATCATC
AGCATATATGATGATTGAGAAAGTATTAGAACTAGCATTTCAATGCGCAGCTCCTAGTAA
ACAGGAAAGACCCACTATGAAGAAGATACGGAAGTCTGTGGAGTGTTAGAAAAGACTTCA
G
■■Homology search results ■■ -
sp_hit_id Q8L4H4
Definition sp|Q8L4H4|NORK_MEDTR Nodulation receptor kinase OS=Medicago truncatula
Align length 173
Score (bit) 149.0
E-value 7.0e-36
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918873|Adiantum capillus-veneris mRNA, clone:
YMU001_000118_E05.
(541 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8L4H4|NORK_MEDTR Nodulation receptor kinase OS=Medicago trun... 149 7e-36
sp|Q8LKZ1|NORK_PEA Nodulation receptor kinase OS=Pisum sativum G... 149 9e-36
sp|Q8GYF5|WAKLR_ARATH Wall-associated receptor kinase-like 21 OS... 140 4e-33
sp|Q9S9M5|WAKLA_ARATH Wall-associated receptor kinase-like 1 OS=... 135 1e-31
sp|Q9LZM4|WAKLQ_ARATH Putative wall-associated receptor kinase-l... 135 1e-31
sp|Q9LX66|Y3290_ARATH Probable receptor-like protein kinase At3g... 135 2e-31
sp|O24585|CRI4_MAIZE Putative receptor protein kinase CRINKLY4 O... 134 4e-31
sp|Q9M342|WAKLP_ARATH Wall-associated receptor kinase-like 15 OS... 133 5e-31
sp|Q9M092|WAKLM_ARATH Wall-associated receptor kinase-like 17 OS... 132 8e-31
sp|Q9C9L5|WAKLH_ARATH Putative wall-associated receptor kinase-l... 132 1e-30
sp|Q0WNY5|WAKLN_ARATH Wall-associated receptor kinase-like 18 OS... 132 1e-30
sp|Q9S9M3|WAKLC_ARATH Wall-associated receptor kinase-like 3 OS=... 132 1e-30
sp|Q9SA25|WAKLG_ARATH Wall-associated receptor kinase-like 8 OS=... 131 2e-30
sp|Q8RY17|WAKLI_ARATH Wall-associated receptor kinase-like 22 OS... 131 2e-30
sp|Q8RY67|WAKLO_ARATH Wall-associated receptor kinase-like 14 OS... 130 5e-30
sp|Q9S9M1|WAKLE_ARATH Wall-associated receptor kinase-like 5 OS=... 130 5e-30
sp|Q9LMN7|WAK5_ARATH Wall-associated receptor kinase 5 OS=Arabid... 129 7e-30
sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1... 129 7e-30
sp|P0C5E2|Y1839_ARATH Putative serine/threonine-protein kinase A... 129 9e-30
sp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 2 OS=... 129 9e-30
sp|Q9LJF3|BRL3_ARATH Serine/threonine-protein kinase BRI1-like 3... 129 1e-29
sp|Q3EDL4|Y1154_ARATH Putative serine/threonine-protein kinase A... 128 2e-29
sp|Q9LMT9|WAKLL_ARATH Putative wall-associated receptor kinase-l... 127 3e-29
sp|P43293|NAK_ARATH Probable serine/threonine-protein kinase NAK... 127 3e-29
sp|Q8VYA3|WAKLJ_ARATH Wall-associated receptor kinase-like 10 OS... 127 5e-29
sp|Q9LN59|WAKLK_ARATH Putative wall-associated receptor kinase-l... 126 6e-29
sp|Q9LMN6|WAK4_ARATH Wall-associated receptor kinase 4 OS=Arabid... 126 8e-29
sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis t... 126 8e-29
sp|P46573|APK1B_ARATH Protein kinase APK1B, chloroplastic OS=Ara... 125 1e-28
sp|Q9S9M2|WAKLD_ARATH Wall-associated receptor kinase-like 4 OS=... 125 2e-28

>sp|Q8L4H4|NORK_MEDTR Nodulation receptor kinase OS=Medicago
truncatula GN=NORK PE=1 SV=2
Length = 925

Score = 149 bits (377), Expect = 7e-36
Identities = 81/173 (46%), Positives = 111/173 (64%)
Frame = +2

Query: 5 IAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGPTDFDATHVST 184
IA+ A L YLH + +S+IHRD+KSSNILL ++ AKVADFGFS+ P + D+ +VS
Sbjct: 699 IALGAARGLAYLHTFPGRSVIHRDVKSSNILLDQSMCAKVADFGFSKYAPQEGDS-YVSL 757

Query: 185 QVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAFQM 364
+V+GTAGYLDPEY KT QL++KSDV+S+GV+L+E+ S R P+ KR E WA
Sbjct: 758 EVRGTAGYLDPEYYKTQQLSEKSDVFSFGVVLLEIVSGREPLNIKRPRIEWSLVEWAKPY 817

Query: 365 FNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKKIRKSVE 523
K E++DP I+ A + +V+E+A QC P RP M I + +E
Sbjct: 818 IRASKVDEIVDPGIKGGYHA-EALWRVVEVALQCLEPYSTYRPCMVDIVRELE 869


>sp|Q8LKZ1|NORK_PEA Nodulation receptor kinase OS=Pisum sativum
GN=NORK PE=1 SV=1
Length = 924

Score = 149 bits (376), Expect = 9e-36
Identities = 81/173 (46%), Positives = 110/173 (63%)
Frame = +2

Query: 5 IAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGPTDFDATHVST 184
IA+ A L YLH + +S+IHRD+KSSNILL + AKVADFGFS+ P + D+ +VS
Sbjct: 698 IALGAARGLAYLHTFPGRSVIHRDVKSSNILLDHSMCAKVADFGFSKYAPQEGDS-YVSL 756

Query: 185 QVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAFQM 364
+V+GTAGYLDPEY KT QL++KSDV+S+GV+L+E+ S R P+ KR E WA
Sbjct: 757 EVRGTAGYLDPEYYKTQQLSEKSDVFSFGVVLLEIVSGREPLNIKRPRVEWSLVEWAKPY 816

Query: 365 FNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKKIRKSVE 523
K E++DP I+ A + +V+E+A QC P RP M I + +E
Sbjct: 817 IRASKVDEIVDPGIKGGYHA-EALWRVVEVALQCLEPYSTYRPCMVDIVRELE 868


>sp|Q8GYF5|WAKLR_ARATH Wall-associated receptor kinase-like 21
OS=Arabidopsis thaliana GN=WAKL21 PE=1 SV=1
Length = 620

Score = 140 bits (353), Expect = 4e-33
Identities = 75/175 (42%), Positives = 110/175 (62%), Gaps = 3/175 (1%)
Frame = +2

Query: 5 IAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLG-PTDFDATHVS 181
IA A+A+ +LH + I HRDIKSSNILL F +K++DFG SRLG TDF+A+H+S
Sbjct: 414 IACQTANAIAHLHSSVNPPIYHRDIKSSNILLDHEFNSKISDFGLSRLGMSTDFEASHIS 473

Query: 182 TQVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAFQ 361
T +GT GYLDP+Y + +QL+ KSDVYS+GV+LVE+ S + I+ R E A
Sbjct: 474 TAPQGTPGYLDPQYHQDFQLSDKSDVYSFGVVLVEIISGFKVIDFTRPYSEVNLASLAVD 533

Query: 362 MFNDGKGIEVLDPKIERTSSAYMM--IEKVLELAFQCAAPSKQERPTMKKIRKSV 520
G+ ++++DP + + + M I + ELAF+C + + RPTM +I + +
Sbjct: 534 RIGRGRVVDIIDPCLNKEINPKMFASIHNLAELAFRCLSFHRNMRPTMVEITEDL 588


>sp|Q9S9M5|WAKLA_ARATH Wall-associated receptor kinase-like 1
OS=Arabidopsis thaliana GN=WAKL1 PE=1 SV=1
Length = 730

Score = 135 bits (341), Expect = 1e-31
Identities = 73/173 (42%), Positives = 106/173 (61%)
Frame = +2

Query: 5 IAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGPTDFDATHVST 184
IAI++A ALTY+H A I HRDIK++NILL E +RAKV+DFG SR D TH++T
Sbjct: 531 IAIEIAGALTYMHSAASFPIFHRDIKTTNILLDEKYRAKVSDFGTSR--SVTLDQTHLTT 588

Query: 185 QVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAFQM 364
V GT GY+DPEY + Q T KSDVYS+GV+LVEL + +P+ + R + R +
Sbjct: 589 LVAGTFGYMDPEYFLSSQYTHKSDVYSFGVVLVELITGEKPLSRVRSEEGRGLATHFLEA 648

Query: 365 FNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKKIRKSVE 523
+ + I+++D +I + S + V +LA +C + RP MK++ +E
Sbjct: 649 MKENRVIDIIDIRI-KDESKLEQVMAVAKLARKCLNRKGKNRPNMKEVSNELE 700


>sp|Q9LZM4|WAKLQ_ARATH Putative wall-associated receptor kinase-like
20 OS=Arabidopsis thaliana GN=WAKL20 PE=3 SV=1
Length = 657

Score = 135 bits (340), Expect = 1e-31
Identities = 73/178 (41%), Positives = 110/178 (61%), Gaps = 5/178 (2%)
Frame = +2

Query: 5 IAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRL---GPTDFDATH 175
IA A L YLH A I HRD+KSSNILL E AKV+DFG SRL T + +H
Sbjct: 467 IAYQTAEGLAYLHSAAQPPIYHRDVKSSNILLDEKLNAKVSDFGLSRLVDLTETANNESH 526

Query: 176 VSTQVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWA 355
+ T +GT GYLDPEY + +QLT KSDVYS+GV+L+E+ ++++ I+ RE ++ +
Sbjct: 527 IFTGAQGTLGYLDPEYYRNFQLTDKSDVYSFGVVLLEMVTSKKAIDFTREEEDVNLVMYI 586

Query: 356 FQMFNDGKGIEVLDPKIERTSSAYMM--IEKVLELAFQCAAPSKQERPTMKKIRKSVE 523
+M + + E +DP +++T++ M I+++ LA C +Q RP+MK++ +E
Sbjct: 587 NKMMDQERLTECIDPLLKKTANKIDMQTIQQLGNLASACLNERRQNRPSMKEVADEIE 644


>sp|Q9LX66|Y3290_ARATH Probable receptor-like protein kinase At3g46290
OS=Arabidopsis thaliana GN=At3g46290 PE=1 SV=1
Length = 830

Score = 135 bits (339), Expect = 2e-31
Identities = 78/180 (43%), Positives = 106/180 (58%)
Frame = +2

Query: 2 DIAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGPTDFDATHVS 181
+I I A L YLH K +IHRD+KS+NILL ENF AKVADFG S+ GP + D THVS
Sbjct: 585 EICIGAARGLHYLHTGDSKPVIHRDVKSANILLDENFMAKVADFGLSKTGP-ELDQTHVS 643

Query: 182 TQVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAFQ 361
T VKG+ GYLDPEY + QLT KSDVYS+GV+L E+ AR I+ + WA +
Sbjct: 644 TAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPVIDPTLPREMVNLAEWAMK 703

Query: 362 MFNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKKIRKSVEC*KRLQ 541
G+ +++D + R + + K E +C A +RP+M + ++E +LQ
Sbjct: 704 WQKKGQLDQIIDQSL-RGNIRPDSLRKFAETGEKCLADYGVDRPSMGDVLWNLEYALQLQ 762


>sp|O24585|CRI4_MAIZE Putative receptor protein kinase CRINKLY4 OS=Zea
mays GN=CR4 PE=2 SV=1
Length = 901

Score = 134 bits (336), Expect = 4e-31
Identities = 74/173 (42%), Positives = 104/173 (60%)
Frame = +2

Query: 5 IAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGPTDFDATHVST 184
IA+ A + YLH YA +IHRDIKSSNIL+ E+ A+VADFG S LGP D T +S
Sbjct: 611 IAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSILGPAD-SGTPLSE 669

Query: 185 QVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAFQM 364
GT GYLDPEY + + LT KSDVYS+GV+L+E+ S R+ I+ + E E WA +
Sbjct: 670 LPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQFE--EGNIVEWAVPL 727

Query: 365 FNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKKIRKSVE 523
G +LDP + S ++K+ +A +C ++RP+M K+ ++E
Sbjct: 728 IKAGDIFAILDPVLSPPSD-LEALKKIASVACKCVRMRGKDRPSMDKVTTALE 779


>sp|Q9M342|WAKLP_ARATH Wall-associated receptor kinase-like 15
OS=Arabidopsis thaliana GN=WAKL15 PE=2 SV=2
Length = 639

Score = 133 bits (335), Expect = 5e-31
Identities = 76/175 (43%), Positives = 105/175 (60%), Gaps = 2/175 (1%)
Frame = +2

Query: 5 IAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGPTDFDATHVST 184
IA A L YLH + I HRD+KSSNILL EN KVADFG SRLG +D +HV+T
Sbjct: 461 IAHQTAQGLDYLHSSSSPPIYHRDVKSSNILLDENLDVKVADFGLSRLGVSD--VSHVTT 518

Query: 185 QVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAFQM 364
+GT GYLDPEY +QLT KSDVYS+GV+L EL + ++ I+ RE ++ + +
Sbjct: 519 CAQGTLGYLDPEYYLNFQLTDKSDVYSFGVVLFELLTCKKAIDFNREEEDVNLVVFVRKA 578

Query: 365 FNDGKGIEVLDP--KIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKKIRKSVE 523
+G+ ++V+DP I T ++ + LA C ++Q RPTM+ K +E
Sbjct: 579 LKEGRLMDVIDPVIGIGATEKEIESMKALGVLAELCVKETRQCRPTMQVAAKEIE 633


>sp|Q9M092|WAKLM_ARATH Wall-associated receptor kinase-like 17
OS=Arabidopsis thaliana GN=WAKL17 PE=2 SV=2
Length = 786

Score = 132 bits (333), Expect = 8e-31
Identities = 72/174 (41%), Positives = 108/174 (62%), Gaps = 1/174 (0%)
Frame = +2

Query: 5 IAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGPTDFDATHVST 184
IA+D+A AL+YLH A I HRDIKS+NILL E +RAKVADFG SR D TH +T
Sbjct: 547 IAVDIAGALSYLHSAASSPIYHRDIKSTNILLDEKYRAKVADFGTSR--SVTIDQTHWTT 604

Query: 185 QVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAFQM 364
+ GT GY+DPEY ++ Q T+KSDVYS+GV+L EL + +P+ + ++E + F++
Sbjct: 605 VISGTVGYVDPEYYRSSQYTEKSDVYSFGVILAELITGDKPVIMVQNTQEIIALAEHFRV 664

Query: 365 -FNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKKIRKSVE 523
+ + +++D +I R S + V LA +C + + RP M+++ +E
Sbjct: 665 AMKERRLSDIMDARI-RDDSKPEQVMAVANLAMKCLSSRGRNRPNMREVFTELE 717


>sp|Q9C9L5|WAKLH_ARATH Putative wall-associated receptor kinase-like 9
OS=Arabidopsis thaliana GN=WAKL9 PE=3 SV=1
Length = 792

Score = 132 bits (332), Expect = 1e-30
Identities = 69/173 (39%), Positives = 104/173 (60%)
Frame = +2

Query: 5 IAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGPTDFDATHVST 184
IAID+A AL+YLH A I HRD+KS+NI+L E +RAKV+DFG SR D TH++T
Sbjct: 550 IAIDIAGALSYLHSSASSPIYHRDVKSTNIMLDEKYRAKVSDFGTSRT--VTVDHTHLTT 607

Query: 185 QVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAFQM 364
V GT GY+DPEY ++ Q T KSDVYS+GV+LVEL + + I R + R +
Sbjct: 608 VVSGTVGYMDPEYFQSSQFTDKSDVYSFGVVLVELITGEKSISFLRSQENRTLATYFILA 667

Query: 365 FNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKKIRKSVE 523
+ K +++D +I R + ++A +C ++RP+M+++ ++
Sbjct: 668 MKENKLFDIIDARI-RDGCMLSQVTATAKVARKCLNLKGRKRPSMREVSMELD 719


tr_hit_id A7VM39
Definition tr|A7VM39|A7VM39_MARPO Receptor-like kinase OS=Marchantia polymorpha
Align length 173
Score (bit) 258.0
E-value 1.0e-67
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918873|Adiantum capillus-veneris mRNA, clone:
YMU001_000118_E05.
(541 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7VM39|A7VM39_MARPO Receptor-like kinase OS=Marchantia polymo... 258 1e-67
tr|A9REV2|A9REV2_PHYPA Predicted protein OS=Physcomitrella paten... 248 1e-64
tr|A9TC28|A9TC28_PHYPA Predicted protein OS=Physcomitrella paten... 248 2e-64
tr|Q8VZJ9|Q8VZJ9_ARATH Putative uncharacterized protein At4g0033... 242 8e-63
tr|A5AIK5|A5AIK5_VITVI Putative uncharacterized protein OS=Vitis... 241 2e-62
tr|Q6K270|Q6K270_ORYSJ Os09g0123300 protein OS=Oryza sativa subs... 240 3e-62
tr|B8BCZ9|B8BCZ9_ORYSI Putative uncharacterized protein OS=Oryza... 240 3e-62
tr|A3BW58|A3BW58_ORYSJ Putative uncharacterized protein OS=Oryza... 240 3e-62
tr|O23069|O23069_ARATH A_IG005I10.8 protein (AT4g00330 protein) ... 239 9e-62
tr|A7PZM8|A7PZM8_VITVI Chromosome chr15 scaffold_40, whole genom... 238 2e-61
tr|A9TY33|A9TY33_PHYPA Predicted protein OS=Physcomitrella paten... 234 2e-60
tr|B6U4V0|B6U4V0_MAIZE Nodulation receptor kinase OS=Zea mays PE... 227 4e-58
tr|A7NYL4|A7NYL4_VITVI Chromosome chr6 scaffold_3, whole genome ... 226 5e-58
tr|A5ALW5|A5ALW5_VITVI Putative uncharacterized protein OS=Vitis... 226 5e-58
tr|Q8H085|Q8H085_ORYSJ Os03g0148700 protein OS=Oryza sativa subs... 225 9e-58
tr|A2XCJ5|A2XCJ5_ORYSI Putative uncharacterized protein OS=Oryza... 225 9e-58
tr|A7QTN5|A7QTN5_VITVI Chromosome chr11 scaffold_170, whole geno... 225 1e-57
tr|A9RIX1|A9RIX1_PHYPA Predicted protein (Fragment) OS=Physcomit... 224 3e-57
tr|A9TKU4|A9TKU4_PHYPA Predicted protein OS=Physcomitrella paten... 222 9e-57
tr|Q5YD56|Q5YD56_MEDSA Calcium/calmodulin-regulated receptor-lik... 222 1e-56
tr|Q9ASQ5|Q9ASQ5_ARATH At2g11520/F14P14.15 (Putative uncharacter... 221 3e-56
tr|Q7XQW7|Q7XQW7_ORYSA OSJNBa0014K14.8 protein OS=Oryza sativa G... 218 2e-55
tr|Q0JBY2|Q0JBY2_ORYSJ Os04g0503600 protein OS=Oryza sativa subs... 218 2e-55
tr|Q01I52|Q01I52_ORYSA OSIGBa0112M24.5 protein OS=Oryza sativa G... 218 2e-55
tr|A3AVC4|A3AVC4_ORYSJ Putative uncharacterized protein OS=Oryza... 218 2e-55
tr|Q6K703|Q6K703_ORYSJ Os02g0821400 protein OS=Oryza sativa subs... 216 5e-55
tr|A9SFY5|A9SFY5_PHYPA Predicted protein OS=Physcomitrella paten... 216 6e-55
tr|Q9FIL7|Q9FIL7_ARATH Similarity to protein kinase (At5g58940) ... 212 9e-54
tr|Q5YCZ4|Q5YCZ4_ARATH Calmodulin-binding receptor-like kinase O... 212 9e-54
tr|Q8W0H6|Q8W0H6_ORYSJ Putative calcium/calmodulin-regulated rec... 207 3e-52

>tr|A7VM39|A7VM39_MARPO Receptor-like kinase OS=Marchantia
polymorpha GN=MpRLK23 PE=2 SV=1
Length = 609

Score = 258 bits (659), Expect = 1e-67
Identities = 122/173 (70%), Positives = 150/173 (86%)
Frame = +2

Query: 2 DIAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGPTDFDATHVS 181
DIAIDVAHALTYLHLYAD+ IIHRD+KSSNILLT+ FRAKVADFGFSR GPT THVS
Sbjct: 362 DIAIDVAHALTYLHLYADRPIIHRDVKSSNILLTDTFRAKVADFGFSRTGPTGQGDTHVS 421

Query: 182 TQVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAFQ 361
TQVKGTAGYLDPEYL TYQL +KSDVYS+G+L++E+F+ RRPIE KR S+ERVT RWAF+
Sbjct: 422 TQVKGTAGYLDPEYLTTYQLNEKSDVYSFGILVIEIFTGRRPIELKRPSEERVTVRWAFK 481

Query: 362 MFNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKKIRKSV 520
F +GK +E+LDP+IE T + YM+IE++ ELAF C+AP+K++RP MKK ++++
Sbjct: 482 KFVEGKVMEILDPRIEHTPAIYMIIERLAELAFACSAPTKRDRPVMKKAQEAL 534


>tr|A9REV2|A9REV2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_113050 PE=4 SV=1
Length = 315

Score = 248 bits (634), Expect = 1e-64
Identities = 120/169 (71%), Positives = 145/169 (85%), Gaps = 1/169 (0%)
Frame = +2

Query: 2 DIAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGP-TDFDATHV 178
DIAID+AHALTYLHLYAD+ IIHRDIKSSNIL+TE +RAKVADFGFSR+GP T+ ATHV
Sbjct: 116 DIAIDIAHALTYLHLYADRPIIHRDIKSSNILITEKYRAKVADFGFSRVGPATEAGATHV 175

Query: 179 STQVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAF 358
STQVKGTAGYLDPEYL TYQL KSDVYS+G+LLVE+F+ RRPIE +R S ER+T RWAF
Sbjct: 176 STQVKGTAGYLDPEYLHTYQLHTKSDVYSFGILLVEIFTGRRPIELRRPSDERITVRWAF 235

Query: 359 QMFNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKK 505
+ F +GK +++LDPKIE+T + +IE + ELAF C+AP+K +RP+MKK
Sbjct: 236 KKFVEGKVVDILDPKIEKTPATLSIIEPLAELAFACSAPTKADRPSMKK 284


>tr|A9TC28|A9TC28_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_220928 PE=4 SV=1
Length = 333

Score = 248 bits (632), Expect = 2e-64
Identities = 118/170 (69%), Positives = 145/170 (85%), Gaps = 1/170 (0%)
Frame = +2

Query: 2 DIAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGP-TDFDATHV 178
DIAID+AHALTYLHLYAD+ IIHRDIKSSNILLTEN+RAKVADFGFSR+GP TD ATHV
Sbjct: 113 DIAIDIAHALTYLHLYADRPIIHRDIKSSNILLTENYRAKVADFGFSRVGPATDAGATHV 172

Query: 179 STQVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAF 358
STQVKGTAGYLDPEYL +YQL KSDVYS+G+LLVE+F+ RRPIE KR +ER+TTRW +
Sbjct: 173 STQVKGTAGYLDPEYLNSYQLHTKSDVYSFGILLVEIFTGRRPIEVKRAKEERITTRWVY 232

Query: 359 QMFNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKKI 508
Q F +GK IE+LDP+IERT + ++++++ LA C+A +K +RP MK++
Sbjct: 233 QKFEEGKVIEILDPQIERTPAVMSVVDRLVNLALTCSAQTKAQRPNMKEV 282


>tr|Q8VZJ9|Q8VZJ9_ARATH Putative uncharacterized protein At4g00330
OS=Arabidopsis thaliana GN=At4g00330 PE=2 SV=1
Length = 411

Score = 242 bits (618), Expect = 8e-63
Identities = 120/169 (71%), Positives = 138/169 (81%), Gaps = 1/169 (0%)
Frame = +2

Query: 2 DIAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGP-TDFDATHV 178
DIA DVAHA+TYLH+Y IIHRDIKSSNILLTEN+RAKVADFGF+RL P TD ATHV
Sbjct: 223 DIATDVAHAITYLHMYTQPPIIHRDIKSSNILLTENYRAKVADFGFARLAPDTDSGATHV 282

Query: 179 STQVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAF 358
STQVKGTAGYLDPEYL TYQLT+KSDVYS+GVLLVEL + RRPIE R KER+T RWA
Sbjct: 283 STQVKGTAGYLDPEYLTTYQLTEKSDVYSFGVLLVELLTGRRPIELSRGQKERITIRWAI 342

Query: 359 QMFNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKK 505
+ F G I VLDPK+E+ S+ + +EKVLE+AFQC AP ++ RP+MKK
Sbjct: 343 KKFTSGDTISVLDPKLEQNSANNLALEKVLEMAFQCLAPHRRSRPSMKK 391


>tr|A5AIK5|A5AIK5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_007757 PE=4 SV=1
Length = 442

Score = 241 bits (614), Expect = 2e-62
Identities = 117/169 (69%), Positives = 139/169 (82%), Gaps = 1/169 (0%)
Frame = +2

Query: 2 DIAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGP-TDFDATHV 178
D+AIDVAHA+TYLH+Y D IIHRDIKSSNILLTEN RAKVADFGF+RL T+ ATHV
Sbjct: 238 DVAIDVAHAITYLHMYTDHPIIHRDIKSSNILLTENLRAKVADFGFARLAADTESGATHV 297

Query: 179 STQVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAF 358
STQVKGTAGYLDPEYL+TYQLT+KSDVYS+GVLLVEL + RRPIE KRE ER+T +WA
Sbjct: 298 STQVKGTAGYLDPEYLRTYQLTEKSDVYSFGVLLVELVTGRRPIEAKRELPERITAKWAM 357

Query: 359 QMFNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKK 505
+ F DG I LDP++ER ++ + +EK+LELA QC AP KQ RP+M++
Sbjct: 358 KKFTDGDAIFTLDPRLERNAANNLALEKILELALQCLAPQKQNRPSMRR 406


>tr|Q6K270|Q6K270_ORYSJ Os09g0123300 protein OS=Oryza sativa subsp.
japonica GN=P0415D04.48 PE=4 SV=1
Length = 526

Score = 240 bits (613), Expect = 3e-62
Identities = 112/169 (66%), Positives = 147/169 (86%)
Frame = +2

Query: 2 DIAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGPTDFDATHVS 181
+IAIDVAHALTYLHLYA+K+IIHRD+KSSNILLTE++RAKV+DFGF+R GP+D + TH+S
Sbjct: 341 EIAIDVAHALTYLHLYAEKTIIHRDVKSSNILLTESYRAKVSDFGFARSGPSDTEKTHIS 400

Query: 182 TQVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAFQ 361
T+VKGTAGYLDPEYL+TYQLT KSDV+S+G+LLVE+ SARRP+E KR ++ER+T RW F+
Sbjct: 401 TKVKGTAGYLDPEYLRTYQLTPKSDVFSFGILLVEILSARRPVELKRAAEERITIRWTFK 460

Query: 362 MFNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKKI 508
FN+G E+LDP +E ++E++L LAFQCAAP++++RPTMK++
Sbjct: 461 KFNEGNRREILDPLLEDPVDD-EVLERLLNLAFQCAAPTREDRPTMKEV 508


>tr|B8BCZ9|B8BCZ9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_30427 PE=4 SV=1
Length = 637

Score = 240 bits (613), Expect = 3e-62
Identities = 112/169 (66%), Positives = 147/169 (86%)
Frame = +2

Query: 2 DIAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGPTDFDATHVS 181
+IAIDVAHALTYLHLYA+K+IIHRD+KSSNILLTE++RAKV+DFGF+R GP+D + TH+S
Sbjct: 334 EIAIDVAHALTYLHLYAEKTIIHRDVKSSNILLTESYRAKVSDFGFARSGPSDTEKTHIS 393

Query: 182 TQVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAFQ 361
T+VKGTAGYLDPEYL+TYQLT KSDV+S+G+LLVE+ SARRP+E KR ++ER+T RW F+
Sbjct: 394 TKVKGTAGYLDPEYLRTYQLTPKSDVFSFGILLVEILSARRPVELKRAAEERITIRWTFK 453

Query: 362 MFNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKKI 508
FN+G E+LDP +E ++E++L LAFQCAAP++++RPTMK++
Sbjct: 454 KFNEGNRREILDPLLEDPVDD-EVLERLLNLAFQCAAPTREDRPTMKEV 501


>tr|A3BW58|A3BW58_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_027280 PE=4 SV=1
Length = 526

Score = 240 bits (613), Expect = 3e-62
Identities = 112/169 (66%), Positives = 147/169 (86%)
Frame = +2

Query: 2 DIAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGPTDFDATHVS 181
+IAIDVAHALTYLHLYA+K+IIHRD+KSSNILLTE++RAKV+DFGF+R GP+D + TH+S
Sbjct: 341 EIAIDVAHALTYLHLYAEKTIIHRDVKSSNILLTESYRAKVSDFGFARSGPSDTEKTHIS 400

Query: 182 TQVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAFQ 361
T+VKGTAGYLDPEYL+TYQLT KSDV+S+G+LLVE+ SARRP+E KR ++ER+T RW F+
Sbjct: 401 TKVKGTAGYLDPEYLRTYQLTPKSDVFSFGILLVEILSARRPVELKRAAEERITIRWTFK 460

Query: 362 MFNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKKI 508
FN+G E+LDP +E ++E++L LAFQCAAP++++RPTMK++
Sbjct: 461 KFNEGNRREILDPLLEDPVDD-EVLERLLNLAFQCAAPTREDRPTMKEV 508


>tr|O23069|O23069_ARATH A_IG005I10.8 protein (AT4g00330 protein)
(F5I10.8 protein) OS=Arabidopsis thaliana
GN=A_IG005I10.8 PE=4 SV=1
Length = 341

Score = 239 bits (609), Expect = 9e-62
Identities = 122/176 (69%), Positives = 140/176 (79%), Gaps = 8/176 (4%)
Frame = +2

Query: 2 DIAIDVAHALTYLHLYADKSI-------IHRDIKSSNILLTENFRAKVADFGFSRLGP-T 157
DIA DVAHA+TYLH+Y KSI IHRDIKSSNILLTEN+RAKVADFGF+RL P T
Sbjct: 146 DIATDVAHAITYLHMYTRKSIVYIEPPIIHRDIKSSNILLTENYRAKVADFGFARLAPDT 205

Query: 158 DFDATHVSTQVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKER 337
D ATHVSTQVKGTAGYLDPEYL TYQLT+KSDVYS+GVLLVEL + RRPIE R KER
Sbjct: 206 DSGATHVSTQVKGTAGYLDPEYLTTYQLTEKSDVYSFGVLLVELLTGRRPIELSRGQKER 265

Query: 338 VTTRWAFQMFNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKK 505
+T RWA + F G I VLDPK+E+ S+ + +EKVLE+AFQC AP ++ RP+MKK
Sbjct: 266 ITIRWAIKKFTSGDTISVLDPKLEQNSANNLALEKVLEMAFQCLAPHRRSRPSMKK 321


>tr|A7PZM8|A7PZM8_VITVI Chromosome chr15 scaffold_40, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00026937001
PE=4 SV=1
Length = 442

Score = 238 bits (606), Expect = 2e-61
Identities = 116/169 (68%), Positives = 138/169 (81%), Gaps = 1/169 (0%)
Frame = +2

Query: 2 DIAIDVAHALTYLHLYADKSIIHRDIKSSNILLTENFRAKVADFGFSRLGP-TDFDATHV 178
D+AIDVAHA+TYLH+Y D IIHRDIKSSNILLTEN RAKVADFGF+RL T+ ATHV
Sbjct: 238 DVAIDVAHAITYLHMYTDHPIIHRDIKSSNILLTENLRAKVADFGFARLAADTESGATHV 297

Query: 179 STQVKGTAGYLDPEYLKTYQLTQKSDVYSYGVLLVELFSARRPIEQKRESKERVTTRWAF 358
STQVKGTAGYLDPEYL+TYQLT+KSDVYS+GVLLVEL + R PIE KRE ER+T +WA
Sbjct: 298 STQVKGTAGYLDPEYLRTYQLTEKSDVYSFGVLLVELVTGRCPIEAKRELPERITAKWAM 357

Query: 359 QMFNDGKGIEVLDPKIERTSSAYMMIEKVLELAFQCAAPSKQERPTMKK 505
+ F DG I LDP++ER ++ + +EK+LELA QC AP KQ RP+M++
Sbjct: 358 KKFTDGDAIFTLDPRLERNAANNLALEKILELALQCLAPQKQNRPSMRR 406