BP918881
Clone id YMU001_000118_F02
Library
Length 294
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000118_F02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TATTCACCTACTGGCTCAAGGTGCCTGATTAAATGGAATCTACACATTCTATTCCATGCA
ATCCCCCCTCCTGGCGGTCGCAATCTGCCGCAGCAGCCCATTGCTCTCCAAGTTCATAGC
TTGGTGCCACTGCCCTCGCTCTGCATTCCTGGTTATTTCTTGCCTCTCATGGCGAGGCAC
TGCCAAGCACGGCATATTCCTCTAGTTTTGCAAAGCATTCCCTAACCATGGTGTGCTTAT
CGACCCAGACCCCCCTTCATACAGTGCACGTTGCCTATCCTCTCCCTGGAAGTA
■■Homology search results ■■ -
sp_hit_id Q6DDP3
Definition sp|Q6DDP3|ENPP6_XENLA Ectonucleotide pyrophosphatase/phosphodiesterase 6 OS=Xenopus laevis
Align length 44
Score (bit) 30.0
E-value 3.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918881|Adiantum capillus-veneris mRNA, clone:
YMU001_000118_F02.
(294 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6DDP3|ENPP6_XENLA Ectonucleotide pyrophosphatase/phosphodies... 30 3.8
sp|A6VW13|NQRF_MARMS Na(+)-translocating NADH-quinone reductase ... 29 6.5
sp|Q8BXQ8|FA53C_MOUSE Protein FAM53C OS=Mus musculus GN=Fam53c P... 29 8.5

>sp|Q6DDP3|ENPP6_XENLA Ectonucleotide
pyrophosphatase/phosphodiesterase 6 OS=Xenopus laevis
GN=enpp6 PE=2 SV=1
Length = 441

Score = 30.0 bits (66), Expect = 3.8
Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
Frame = +1

Query: 70 PGGRNLPQQPIALQVHSLVP-LPSLCIPGYFLPLMARHCQARHI 198
PG R++ ++ + +V + P PSL P Y+ + RHC+ H+
Sbjct: 48 PGFRHMVERGV--KVDYMTPAFPSLSYPNYYTLMTGRHCETHHM 89


>sp|A6VW13|NQRF_MARMS Na(+)-translocating NADH-quinone reductase
subunit F OS=Marinomonas sp. (strain MWYL1) GN=nqrF PE=3
SV=1
Length = 408

Score = 29.3 bits (64), Expect = 6.5
Identities = 18/58 (31%), Positives = 29/58 (50%)
Frame = +1

Query: 25 LIKWNLHILFHAIPPPGGRNLPQQPIALQVHSLVPLPSLCIPGYFLPLMARHCQARHI 198
++K+N+ I A PPPG +LP ++ V SL P + + G F A+ A +
Sbjct: 223 IVKFNIRI---ASPPPGKDDLPPGQMSSYVFSLKPGDKIKVYGPFGEFFAKDTDAEMV 277


>sp|Q8BXQ8|FA53C_MOUSE Protein FAM53C OS=Mus musculus GN=Fam53c PE=1
SV=1
Length = 393

Score = 28.9 bits (63), Expect = 8.5
Identities = 20/62 (32%), Positives = 27/62 (43%)
Frame = +1

Query: 67 PPGGRNLPQQPIALQVHSLVPLPSLCIPGYFLPLMARHCQARHIPLVLQSIP*PWCAYRP 246
PP N P++P QV S P +P P RHC++ +P+ L W RP
Sbjct: 80 PPSRGNSPKEPPLSQVLSPEPPDPEKLPVPPAPPSKRHCRSLSVPVDLSRWQPVW---RP 136

Query: 247 RP 252
P
Sbjct: 137 AP 138


tr_hit_id Q21JR7
Definition tr|Q21JR7|Q21JR7_SACD2 NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Align length 60
Score (bit) 34.7
E-value 2.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918881|Adiantum capillus-veneris mRNA, clone:
YMU001_000118_F02.
(294 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q21JR7|Q21JR7_SACD2 NADH:ubiquinone oxidoreductase, Na(+)-tra... 35 2.4
tr|Q7SE82|Q7SE82_NEUCR Predicted protein (Putative uncharacteriz... 35 2.4
tr|B1Q469|B1Q469_ANTMA Flavonoid glucoyltransferase UGT73N1 OS=A... 33 7.0
tr|Q9C4X9|Q9C4X9_SULIS ORF64 OS=Sulfolobus islandicus PE=4 SV=1 33 7.1
tr|B4MZN6|B4MZN6_DROWI GK24689 OS=Drosophila willistoni GN=GK246... 33 9.2
tr|Q6CEK4|Q6CEK4_YARLI YALI0B14971p OS=Yarrowia lipolytica GN=YA... 33 9.2

>tr|Q21JR7|Q21JR7_SACD2 NADH:ubiquinone oxidoreductase,
Na(+)-translocating, F subunit OS=Saccharophagus
degradans (strain 2-40 / ATCC 43961 / DSM 17024)
GN=Sde_1802 PE=4 SV=1
Length = 407

Score = 34.7 bits (78), Expect = 2.4
Identities = 19/60 (31%), Positives = 32/60 (53%)
Frame = +1

Query: 19 RCLIKWNLHILFHAIPPPGGRNLPQQPIALQVHSLVPLPSLCIPGYFLPLMARHCQARHI 198
R L+K+N+ I A PPPG + +P ++ V SL P ++ + G F A+ +A +
Sbjct: 220 RGLVKFNIRI---ATPPPGSKGIPPGQMSSYVFSLKPGDTITVYGPFGEFFAKETEAEMV 276


>tr|Q7SE82|Q7SE82_NEUCR Predicted protein (Putative uncharacterized
protein B13D15.180) OS=Neurospora crassa GN=B13D15.180
PE=4 SV=1
Length = 851

Score = 34.7 bits (78), Expect = 2.4
Identities = 17/51 (33%), Positives = 26/51 (50%)
Frame = -3

Query: 172 P*EARNNQECRARAVAPSYELGEQWAAAADCDRQEGGLHGIECVDSI*SGT 20
P ++ E A PS+E+ + W + D +EGG+ G+E V I S T
Sbjct: 624 PKHEKDKNEEPAVPAEPSFEVAQVWRMSKIVDEEEGGMGGVESVKDIRSST 674


>tr|B1Q469|B1Q469_ANTMA Flavonoid glucoyltransferase UGT73N1
OS=Antirrhinum majus GN=AmUGT38 PE=2 SV=1
Length = 495

Score = 33.1 bits (74), Expect = 7.0
Identities = 15/40 (37%), Positives = 24/40 (60%)
Frame = +1

Query: 91 QQPIALQVHSLVPLPSLCIPGYFLPLMARHCQARHIPLVL 210
QQPI ++ +L+PLPS I +P A+ C+ IP ++
Sbjct: 107 QQPIEEELRNLIPLPSCVICDKHIPWTAQTCKNLRIPRII 146


>tr|Q9C4X9|Q9C4X9_SULIS ORF64 OS=Sulfolobus islandicus PE=4 SV=1
Length = 64

Score = 33.1 bits (74), Expect = 7.1
Identities = 20/50 (40%), Positives = 26/50 (52%)
Frame = +3

Query: 129 TALALHSWLFLASHGEALPSTAYSSSFAKHSLTMVCLSTQTPLHTVHVAY 278
+ L S+ F AS + A+S SFAK L LS+ TPL + H AY
Sbjct: 3 SVLLCKSYFFFASVLTQIYKPAFSHSFAKLYLLSSLLSSSTPLLSFHFAY 52


>tr|B4MZN6|B4MZN6_DROWI GK24689 OS=Drosophila willistoni GN=GK24689
PE=4 SV=1
Length = 559

Score = 32.7 bits (73), Expect = 9.2
Identities = 23/77 (29%), Positives = 37/77 (48%)
Frame = +1

Query: 34 WNLHILFHAIPPPGGRNLPQQPIALQVHSLVPLPSLCIPGYFLPLMARHCQARHIPLVLQ 213
W+ + + PPP N+P QP A+ +H P+P+ GY +P+ P ++
Sbjct: 480 WHSNYYHNFHPPPNNFNMPPQPAAMGMH--FPVPNY---GYGMPMGMP-------PHMMP 527

Query: 214 SIP*PWCAYRPRPPFIQ 264
++P Y P PPF Q
Sbjct: 528 AMP---QMYAPPPPFGQ 541


>tr|Q6CEK4|Q6CEK4_YARLI YALI0B14971p OS=Yarrowia lipolytica
GN=YALI0B14971g PE=4 SV=1
Length = 1329

Score = 32.7 bits (73), Expect = 9.2
Identities = 23/67 (34%), Positives = 30/67 (44%)
Frame = +1

Query: 55 HAIPPPGGRNLPQQPIALQVHSLVPLPSLCIPGYFLPLMARHCQARHIPLVLQSIP*PWC 234
HA+PPP + P A Q S P P + +P A QA +P LQ +P P
Sbjct: 954 HAVPPPPPPHAPDAHHAPQPPSRAPPPPVPNASPPMPRHAPPPQAAPVPPALQHVP-PPP 1012

Query: 235 AYRPRPP 255
+ P PP
Sbjct: 1013 QHAPAPP 1019