BP918883
Clone id YMU001_000118_F04
Library
Length 381
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000118_F04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGTGTGCCCCGTTTGTGGCAGTCGGGGGCTGGTTTGAGGGCAAAATTGCAAGGGAGGCTA
GGGAGGTGAGGCCCATGTGCATGCAACAAAGAAGTATAGTGGATTATATTTTAGCTCTAA
GATTACGCAGATTGGTGACCTTGAGACATCACCTTAACTGATGCAGTGGCTATTGATCTT
TCATATTTGTCCTTTACAGTGGACTATTCTTACACTTTGGAGAATACACACAATACACAA
ATTTTCCCGATAGCCACCCGAGAGACAGATTGGGTGTACATGGCGGAGGTTGGAGTAGAT
GTAATACTGTTAACATAGTCGCAATCGTGACATTCCCTCCCATTTAAAATGAGAGCCCGT
GTCAAAGAAATGACTTCTGAT
■■Homology search results ■■ -
sp_hit_id Q8EDD7
Definition sp|Q8EDD7|Y2823_SHEON Uncharacterized response regulatory protein SO_2823 OS=Shewanella oneidensis
Align length 39
Score (bit) 28.9
E-value 8.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918883|Adiantum capillus-veneris mRNA, clone:
YMU001_000118_F04.
(381 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8EDD7|Y2823_SHEON Uncharacterized response regulatory protei... 29 8.2
sp|Q9FQ03|XRN3_ARATH 5'-3' exoribonuclease 3 OS=Arabidopsis thal... 29 8.2

>sp|Q8EDD7|Y2823_SHEON Uncharacterized response regulatory protein
SO_2823 OS=Shewanella oneidensis GN=SO_2823 PE=3 SV=1
Length = 236

Score = 28.9 bits (63), Expect = 8.2
Identities = 11/39 (28%), Positives = 19/39 (48%)
Frame = -1

Query: 303 YIYSNLRHVHPICLSGGYRENLCIVCILQSVRIVHCKGQ 187
Y++S+L +H C G L + + + +VHC Q
Sbjct: 153 YVFSDLSGIHVACTKGKVHTQLTLKVLEEKTPLVHCHRQ 191


>sp|Q9FQ03|XRN3_ARATH 5'-3' exoribonuclease 3 OS=Arabidopsis
thaliana GN=XRN3 PE=2 SV=1
Length = 1020

Score = 28.9 bits (63), Expect = 8.2
Identities = 13/36 (36%), Positives = 17/36 (47%)
Frame = +2

Query: 47 CKXXXXXEAHVHATKKYSGLYFSSKITQIGDLETSP 154
C +AH H T+ G+ F K IGDL+ P
Sbjct: 782 CCIYRLPDAHEHITRPPPGVIFPKKTVDIGDLKPPP 817


tr_hit_id Q55CG1
Definition tr|Q55CG1|Q55CG1_DICDI Putative uncharacterized protein OS=Dictyostelium discoideum
Align length 38
Score (bit) 33.1
E-value 7.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918883|Adiantum capillus-veneris mRNA, clone:
YMU001_000118_F04.
(381 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q55CG1|Q55CG1_DICDI Putative uncharacterized protein OS=Dicty... 33 7.0

>tr|Q55CG1|Q55CG1_DICDI Putative uncharacterized protein
OS=Dictyostelium discoideum GN=DDB_0201942 PE=4 SV=1
Length = 217

Score = 33.1 bits (74), Expect = 7.0
Identities = 13/38 (34%), Positives = 22/38 (57%)
Frame = -2

Query: 359 RALILNGRECHDCDYVNSITSTPTSAMYTQSVSRVAIG 246
R L +NG++C CD++ S+ TS M++ S + G
Sbjct: 49 RKLSVNGKDCTRCDWIQSLNKCTTSGMFSLSSVDIPFG 86