BP918890
Clone id YMU001_000118_F11
Library
Length 469
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000118_F11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTCATTCCAGATATACAGAGAGGGTGTGGATCCCACATAATTGGTATAAGAAAACTTCCC
AGTCCACCACTTCCGGATCTCTGGGCTTAACATATCAAGATATGAAGAAGACCCTGGCCA
GCACCATCCATCATAATCCCTTCCATGAATATCCTTCACATAATAGCCCTTGGACGTAGC
CTCCTTGTGAAGGAAATACCCGTCATCCCTTTTAATATGAGGATCAACAATTGTTACCAT
ATGGCGACCCTTGCTCATGAGCTTCTCCTGCATTTCTTTTGGATCAGGAAATAAATGTTT
ATCAAATGTGAAGTACCGCTTGCCATCAGTGTGCTCAATGTCAAGCCAAAGCACATCGTA
TGGGATGTCAAACTCATCAAAGCTATCATCAACATTGTAGACATCTGCTTCATCTTTATA
GTTCCAGCGGGACTGATGGTAAGCTGTGGCAAAAAATTGAGGCATACTA
■■Homology search results ■■ -
sp_hit_id Q94502
Definition sp|Q94502|GANAB_DICDI Neutral alpha-glucosidase AB OS=Dictyostelium discoideum
Align length 156
Score (bit) 242.0
E-value 5.0e-64
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918890|Adiantum capillus-veneris mRNA, clone:
YMU001_000118_F11.
(469 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q94502|GANAB_DICDI Neutral alpha-glucosidase AB OS=Dictyostel... 242 5e-64
sp|Q4R4N7|GANAB_MACFA Neutral alpha-glucosidase AB OS=Macaca fas... 214 2e-55
sp|Q14697|GANAB_HUMAN Neutral alpha-glucosidase AB OS=Homo sapie... 213 3e-55
sp|Q8BHN3|GANAB_MOUSE Neutral alpha-glucosidase AB OS=Mus muscul... 213 3e-55
sp|P79403|GANAB_PIG Neutral alpha-glucosidase AB OS=Sus scrofa G... 202 6e-52
sp|Q8TET4|GANC_HUMAN Neutral alpha-glucosidase C OS=Homo sapiens... 201 1e-51
sp|Q9BE70|GANC_MACFA Neutral alpha-glucosidase C (Fragment) OS=M... 199 7e-51
sp|Q8BVW0|GANC_MOUSE Neutral alpha-glucosidase C OS=Mus musculus... 195 1e-49
sp|P38138|GLU2A_YEAST Glucosidase 2 subunit alpha OS=Saccharomyc... 147 3e-35
sp|Q9F234|AGL2_BACTQ Alpha-glucosidase 2 OS=Bacillus thermoamylo... 127 2e-29
sp|Q6P7A9|LYAG_RAT Lysosomal alpha-glucosidase OS=Rattus norvegi... 88 2e-17
sp|P70699|LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus... 87 4e-17
sp|Q9URX4|YFZB_SCHPO Uncharacterized family 31 glucosidase C1039... 85 1e-16
sp|Q9MYM4|LYAG_BOVIN Lysosomal alpha-glucosidase OS=Bos taurus G... 85 1e-16
sp|O04931|AGLU_BETVU Alpha-glucosidase OS=Beta vulgaris PE=1 SV=1 85 1e-16
sp|P10253|LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens... 85 2e-16
sp|Q9C0Y4|AGLU_SCHPO Alpha-glucosidase OS=Schizosaccharomyces po... 85 2e-16
sp|O74254|AMYG_CANAL Glucoamylase 1 OS=Candida albicans GN=GAM1 ... 84 2e-16
sp|Q5R7A9|LYAG_PONAB Lysosomal alpha-glucosidase OS=Pongo abelii... 82 2e-15
sp|Q92442|AGLU_MUCJA Alpha-glucosidase OS=Mucor javanicus PE=1 SV=1 82 2e-15
sp|P56526|AGLU_ASPNG Alpha-glucosidase OS=Aspergillus niger GN=a... 80 3e-15
sp|Q12558|AGLU_ASPOR Alpha-glucosidase OS=Aspergillus oryzae GN=... 78 2e-14
sp|Q9S7Y7|XYL1_ARATH Alpha-xylosidase OS=Arabidopsis thaliana GN... 76 8e-14
sp|P29064|AGLU_CANTS Alpha-glucosidase OS=Candida tsukubaensis P... 74 3e-13
sp|Q653V7|AGLU_ORYSJ Probable alpha-glucosidase Os06g0675700 OS=... 73 5e-13
sp|O00906|AGLU_TETPY Lysosomal acid alpha-glucosidase OS=Tetrahy... 73 7e-13
sp|O59645|AGLU_SULSO Alpha-glucosidase OS=Sulfolobus solfataricu... 72 1e-12
sp|O04893|AGLU_SPIOL Alpha-glucosidase OS=Spinacia oleracea PE=1... 70 6e-12
sp|Q09901|YAJ1_SCHPO Uncharacterized family 31 glucosidase C30D1... 69 8e-12
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sap... 69 1e-11

>sp|Q94502|GANAB_DICDI Neutral alpha-glucosidase AB OS=Dictyostelium
discoideum GN=modA PE=3 SV=1
Length = 943

Score = 242 bits (618), Expect = 5e-64
Identities = 104/156 (66%), Positives = 123/156 (78%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
++PQ F+ YHQ +WNYK E DV VD+ FDE IPYDV+WLDIEHTDGKRYFT+D + F
Sbjct: 385 ALPQMFSLGYHQCKWNYKSEDDVKQVDNGFDENHIPYDVIWLDIEHTDGKRYFTWDNNNF 444

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P P +MQ + +K R MVTIVDPHIKRD+ Y++H EATSKGYY+K+ G DYDGWCWPGS
Sbjct: 445 PTPADMQNIIGAKHRKMVTIVDPHIKRDNNYYVHSEATSKGYYIKNKDGNDYDGWCWPGS 504

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
SSYLD +PEIRKWW +F Y Y GSTP+LYIWND
Sbjct: 505 SSYLDFTNPEIRKWWATQFGYDKYKGSTPNLYIWND 540


>sp|Q4R4N7|GANAB_MACFA Neutral alpha-glucosidase AB OS=Macaca
fascicularis GN=GANAB PE=2 SV=1
Length = 944

Score = 214 bits (544), Expect = 2e-55
Identities = 91/156 (58%), Positives = 111/156 (71%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
++P F+ YHQSRWNY+DEADV VD FDE ++P DV+WLDIEH DGKRYFT+D F
Sbjct: 387 ALPPLFSLGYHQSRWNYRDEADVLEVDQGFDEHNLPCDVIWLDIEHADGKRYFTWDPSRF 446

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P P+ M E+L SK R +V IVDPHIK D GY +H E + G YVK G DY+GWCWPGS
Sbjct: 447 PQPRTMLERLASKRRKLVAIVDPHIKVDSGYRVHDELRNLGLYVKTRDGSDYEGWCWPGS 506

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
+ Y D +P +R WW FSY NY GS P+L++WND
Sbjct: 507 AGYPDFTNPTMRAWWANMFSYDNYEGSAPNLFVWND 542


>sp|Q14697|GANAB_HUMAN Neutral alpha-glucosidase AB OS=Homo sapiens
GN=GANAB PE=1 SV=3
Length = 944

Score = 213 bits (543), Expect = 3e-55
Identities = 90/156 (57%), Positives = 112/156 (71%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
++P F+ YHQSRWNY+DEADV VD FD+ ++P DV+WLDIEH DGKRYFT+D F
Sbjct: 387 ALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHNLPCDVIWLDIEHADGKRYFTWDPSRF 446

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P P+ M E+L SK R +V IVDPHIK D GY +H+E + G YVK G DY+GWCWPGS
Sbjct: 447 PQPRTMLERLASKRRKLVAIVDPHIKVDSGYRVHEELRNLGLYVKTRDGSDYEGWCWPGS 506

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
+ Y D +P +R WW FSY NY GS P+L++WND
Sbjct: 507 AGYPDFTNPTMRAWWANMFSYDNYEGSAPNLFVWND 542


>sp|Q8BHN3|GANAB_MOUSE Neutral alpha-glucosidase AB OS=Mus musculus
GN=Ganab PE=1 SV=1
Length = 944

Score = 213 bits (542), Expect = 3e-55
Identities = 91/156 (58%), Positives = 112/156 (71%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
++P F+ YHQSRWNY+DEADV VD FD+ ++P DV+WLDIEH DGKRYFT+D F
Sbjct: 387 ALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHNMPCDVIWLDIEHADGKRYFTWDPTRF 446

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P P M E L SK R +V IVDPHIK D GY +H+E + G YVK G DY+GWCWPGS
Sbjct: 447 PQPLNMLEHLASKRRKLVAIVDPHIKVDSGYRVHEELRNHGLYVKTRDGSDYEGWCWPGS 506

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
+SY D +P +R WW+ FS+ NY GS P+LY+WND
Sbjct: 507 ASYPDFTNPRMRAWWSNMFSFDNYEGSAPNLYVWND 542


>sp|P79403|GANAB_PIG Neutral alpha-glucosidase AB OS=Sus scrofa
GN=GANAB PE=1 SV=1
Length = 944

Score = 202 bits (514), Expect = 6e-52
Identities = 85/156 (54%), Positives = 110/156 (70%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
++P F+ YHQSRWNY+DEADV V+ FD+ ++P D +WLDIEH DGKRYFT+D F
Sbjct: 387 ALPPLFSLGYHQSRWNYRDEADVLEVNQGFDDHNLPCDFIWLDIEHADGKRYFTWDPSRF 446

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P P+ M E L SK R +V IVDPHIK D Y +H+E + G YVK G DY+GWCWPG+
Sbjct: 447 PQPRTMLEHLASKRRKLVAIVDPHIKVDSSYRVHEELQNLGLYVKTRDGSDYEGWCWPGA 506

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
+SY D +P++R WW F + NY GS+ +LY+WND
Sbjct: 507 ASYPDFTNPKMRAWWADMFRFENYEGSSSNLYVWND 542


>sp|Q8TET4|GANC_HUMAN Neutral alpha-glucosidase C OS=Homo sapiens
GN=GANC PE=2 SV=2
Length = 914

Score = 201 bits (511), Expect = 1e-51
Identities = 87/156 (55%), Positives = 115/156 (73%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
+MP F+ YHQ RWNY+DE DV VD FDE DIPYD +WLDIEHT+GKRYFT+DK+ F
Sbjct: 356 AMPPLFSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKNRF 415

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P+PK MQE L SK R +V I DPHIK D Y ++ +A +G++VK+ G D++G CWPG
Sbjct: 416 PNPKRMQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGL 475

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
SSYLD +P++R+W++ F++ Y GST L++WND
Sbjct: 476 SSYLDFTNPKVREWYSSLFAFPVYQGSTDILFLWND 511


>sp|Q9BE70|GANC_MACFA Neutral alpha-glucosidase C (Fragment)
OS=Macaca fascicularis GN=GANC PE=2 SV=2
Length = 769

Score = 199 bits (505), Expect = 7e-51
Identities = 86/156 (55%), Positives = 114/156 (73%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
+MP F+ YHQ RWNY+DE DV VD FDE DIPYD +WLDIEHT+GKRYFT+DK F
Sbjct: 211 AMPPLFSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKKRF 270

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P+P+ MQE L SK R +V I DPHIK D Y ++ +A +G++VK+ G D++G CWPG
Sbjct: 271 PNPERMQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGL 330

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
SSYLD +P++R+W++ F++ Y GST L++WND
Sbjct: 331 SSYLDFTNPKVREWYSSLFAFPVYQGSTDILFLWND 366


>sp|Q8BVW0|GANC_MOUSE Neutral alpha-glucosidase C OS=Mus musculus
GN=Ganc PE=2 SV=2
Length = 898

Score = 195 bits (495), Expect = 1e-49
Identities = 85/156 (54%), Positives = 113/156 (72%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
+MP F+ YHQ RWNY+DE DV VD FDE DIPYDV+WLDIEHT+ K+YFT+DK F
Sbjct: 340 AMPPLFSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEDKKYFTWDKKRF 399

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
+PK MQE L SK R +V I DPHIK D Y ++ +A +G++VK+ G D++G CWPG
Sbjct: 400 ANPKRMQELLRSKKRKLVVISDPHIKVDPDYTVYAQAKEQGFFVKNPEGGDFEGVCWPGL 459

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
SSYLD +P++R+W++ F++ Y GST L++WND
Sbjct: 460 SSYLDFTNPKVREWYSSLFAFPVYQGSTDILFLWND 495


>sp|P38138|GLU2A_YEAST Glucosidase 2 subunit alpha OS=Saccharomyces
cerevisiae GN=ROT2 PE=1 SV=1
Length = 954

Score = 147 bits (370), Expect = 3e-35
Identities = 66/156 (42%), Positives = 96/156 (61%), Gaps = 1/156 (0%)
Frame = -2

Query: 465 MPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLFP 286
+P + YHQ RWNY DE DV VD D IPYD +WLD+E+T+ K+YFT+ +H FP
Sbjct: 384 LPPISSIGYHQCRWNYNDEMDVLTVDSQMDAHMIPYDFIWLDLEYTNDKKYFTWKQHSFP 443

Query: 285 DPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGSS 106
+PK + KL GR++V ++DPH+K+D Y + ++ VKD +G DY G CWPG+S
Sbjct: 444 NPKRLLSKLKKLGRNLVVLIDPHLKKD--YEISDRVINENVAVKDHNGNDYVGHCWPGNS 501

Query: 105 SYLDMLSPEIRKWWTGKFS-YTNYVGSTPSLYIWND 1
++D +S +K W F + + +L+IWND
Sbjct: 502 IWIDTISKYGQKIWKSFFERFMDLPADLTNLFIWND 537


>sp|Q9F234|AGL2_BACTQ Alpha-glucosidase 2 OS=Bacillus
thermoamyloliquefaciens PE=3 SV=1
Length = 787

Score = 127 bits (320), Expect = 2e-29
Identities = 62/155 (40%), Positives = 92/155 (59%)
Frame = -2

Query: 465 MPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLFP 286
+P +A YHQSR++Y+ E +V + +F E DIP DV++LDI + +G R FTFD++ FP
Sbjct: 256 LPPKWALGYHQSRYSYETEQEVREIAQTFIEKDIPLDVIYLDIHYMNGYRVFTFDRNRFP 315

Query: 285 DPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGSS 106
+ K++ L KG +V IVDP +K D Y +++E Y+ K I G Y G WPG S
Sbjct: 316 NLKQLIADLKQKGIRVVPIVDPGVKEDPEYVIYQEGIRHDYFCKYIEGNVYFGEVWPGKS 375

Query: 105 SYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
++ D + ++RKWW K + +G IWND
Sbjct: 376 AFPDFTNKKVRKWWGEKHQFYTDLGIEG---IWND 407


tr_hit_id Q9FN05
Definition tr|Q9FN05|Q9FN05_ARATH Glucosidase II alpha subunit OS=Arabidopsis thaliana
Align length 156
Score (bit) 282.0
E-value 5.0e-75
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918890|Adiantum capillus-veneris mRNA, clone:
YMU001_000118_F11.
(469 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9FN05|Q9FN05_ARATH Glucosidase II alpha subunit OS=Arabidops... 282 5e-75
tr|A9SRV0|A9SRV0_PHYPA Predicted protein OS=Physcomitrella paten... 281 2e-74
tr|A7QHK1|A7QHK1_VITVI Chromosome chr5 scaffold_98, whole genome... 277 2e-73
tr|A7PB21|A7PB21_VITVI Chromosome chr16 scaffold_10, whole genom... 273 3e-72
tr|Q70AC6|Q70AC6_SOLLC Alpha glucosidase II OS=Solanum lycopersi... 272 7e-72
tr|B5U8Z1|B5U8Z1_HORVU Alpha-glucosidase like protein OS=Hordeum... 271 9e-72
tr|O24375|O24375_SOLTU Alpha-glucosidase OS=Solanum tuberosum PE... 271 2e-71
tr|Q10PY8|Q10PY8_ORYSJ Neutral alpha-glucosidase AB, putative, e... 261 9e-69
tr|Q0DTY9|Q0DTY9_ORYSJ Os03g0216600 protein (Fragment) OS=Oryza ... 261 9e-69
tr|B8AQU2|B8AQU2_ORYSI Putative uncharacterized protein OS=Oryza... 261 9e-69
tr|A3AFI0|A3AFI0_ORYSJ Putative uncharacterized protein OS=Oryza... 261 9e-69
tr|B6PVS7|B6PVS7_BRAFL Putative uncharacterized protein OS=Branc... 237 2e-61
tr|B6NZZ6|B6NZZ6_BRAFL Putative uncharacterized protein OS=Branc... 237 2e-61
tr|B7FVT3|B7FVT3_PHATR Alpha subunit of glucosidase OS=Phaeodact... 236 3e-61
tr|Q013B4|Q013B4_OSTTA Alpha glucosidase II (ISS) OS=Ostreococcu... 235 7e-61
tr|B5YMK8|B5YMK8_THAPS Glucosidase II alpha subunit OS=Thalassio... 235 7e-61
tr|A8IRW5|A8IRW5_CHLRE Glycoside-hydrolase-like protein OS=Chlam... 229 4e-59
tr|B3RJS4|B3RJS4_TRIAD Putative uncharacterized protein OS=Trich... 227 2e-58
tr|A7RJ81|A7RJ81_NEMVE Predicted protein OS=Nematostella vectens... 221 1e-56
tr|A1L3J7|A1L3J7_XENLA LOC100037025 protein OS=Xenopus laevis GN... 218 2e-55
tr|A4S1L4|A4S1L4_OSTLU Predicted protein (Fragment) OS=Ostreococ... 218 2e-55
tr|Q9U3F8|Q9U3F8_CAEEL Protein F40F9.6b, confirmed by transcript... 214 2e-54
tr|Q20239|Q20239_CAEEL Protein F40F9.6a, confirmed by transcript... 214 2e-54
tr|Q5R749|Q5R749_PONAB Putative uncharacterized protein DKFZp459... 213 3e-54
tr|B4DSM6|B4DSM6_HUMAN cDNA FLJ54057, highly similar to Neutral ... 213 3e-54
tr|B4DJ30|B4DJ30_HUMAN cDNA FLJ61290, highly similar to Neutral ... 213 3e-54
tr|Q3UE86|Q3UE86_MOUSE Putative uncharacterized protein (Fragmen... 213 4e-54
tr|Q149A6|Q149A6_MOUSE Ganab protein OS=Mus musculus GN=Ganab PE... 213 4e-54
tr|A1A4T2|A1A4T2_MOUSE Alpha glucosidase 2 alpha neutral subunit... 213 4e-54
tr|B4DIW2|B4DIW2_HUMAN cDNA FLJ54035, highly similar to Neutral ... 212 9e-54

>tr|Q9FN05|Q9FN05_ARATH Glucosidase II alpha subunit OS=Arabidopsis
thaliana GN=At5g63840 PE=4 SV=1
Length = 921

Score = 282 bits (722), Expect = 5e-75
Identities = 125/156 (80%), Positives = 134/156 (85%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
+MPQ FAT YHQ RWNYKDE DV VD FDE DIPYDVLWLDIEHTDGKRYFT+D LF
Sbjct: 357 AMPQLFATGYHQCRWNYKDEEDVAQVDSKFDEHDIPYDVLWLDIEHTDGKRYFTWDSVLF 416

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P P+EMQ+KL +KGR MVTIVDPHIKRDD YFLHKEAT GYYVKD G+D+DGWCWPGS
Sbjct: 417 PHPEEMQKKLAAKGRKMVTIVDPHIKRDDSYFLHKEATQMGYYVKDSSGKDFDGWCWPGS 476

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
SSY+DMLSPEIRKWW G+FSY NYVGSTPSLY WND
Sbjct: 477 SSYIDMLSPEIRKWWGGRFSYKNYVGSTPSLYTWND 512


>tr|A9SRV0|A9SRV0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_187728 PE=4 SV=1
Length = 929

Score = 281 bits (718), Expect = 2e-74
Identities = 120/156 (76%), Positives = 138/156 (88%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
++PQ F+TAYHQ RWNYKDEADV VD FDE+DIPYD +WLDIEHTDGK+YFT+DK+LF
Sbjct: 361 AIPQLFSTAYHQCRWNYKDEADVAGVDAGFDEYDIPYDTIWLDIEHTDGKKYFTWDKNLF 420

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P+PKEMQ K+ +KGRHMVTIVDPH+KRDDGY LHKEATS GYYVKD G+D+DGWCWPG+
Sbjct: 421 PNPKEMQNKIAAKGRHMVTIVDPHMKRDDGYSLHKEATSHGYYVKDRDGKDFDGWCWPGA 480

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
SSYLDML+ E+R WW KFSY+NYVGSTP LYIWND
Sbjct: 481 SSYLDMLNSEVRSWWANKFSYSNYVGSTPILYIWND 516


>tr|A7QHK1|A7QHK1_VITVI Chromosome chr5 scaffold_98, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038818001
PE=4 SV=1
Length = 913

Score = 277 bits (709), Expect = 2e-73
Identities = 122/156 (78%), Positives = 136/156 (87%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
+MPQ F+TAYHQ RWNY+DE DV NVD FDE DIPYDVLWLDIEHTDGKRYFT+D+ LF
Sbjct: 350 AMPQLFSTAYHQCRWNYRDEEDVENVDSKFDEHDIPYDVLWLDIEHTDGKRYFTWDRVLF 409

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P+P++MQ KL +KGRHMVTIVDPHIKRD+ + LHKEATSKGYYVKD G+DYDGWCWPGS
Sbjct: 410 PNPEQMQNKLAAKGRHMVTIVDPHIKRDESFHLHKEATSKGYYVKDATGKDYDGWCWPGS 469

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
SSY DML+PEIR WW+ KFS NYVGSTP LYIWND
Sbjct: 470 SSYPDMLNPEIRSWWSEKFSLKNYVGSTPWLYIWND 505


>tr|A7PB21|A7PB21_VITVI Chromosome chr16 scaffold_10, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00013914001
PE=4 SV=1
Length = 914

Score = 273 bits (698), Expect = 3e-72
Identities = 119/156 (76%), Positives = 136/156 (87%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
+MPQ F+TA+HQ RWNY+DE DV NVD FDE DIPYDVLWLDI+HTDGKRYFT+D+ LF
Sbjct: 351 AMPQLFSTAHHQCRWNYRDEEDVENVDSKFDEHDIPYDVLWLDIDHTDGKRYFTWDRVLF 410

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P+P++MQ KL +KGRHMVTIVDPHI+RD+ + LHKEATSKGYYVKD G+DYDGWCWPGS
Sbjct: 411 PNPEQMQNKLAAKGRHMVTIVDPHIRRDESFHLHKEATSKGYYVKDATGKDYDGWCWPGS 470

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
SSY DML+PEIR WW+ KFS NYVGSTP LYIWND
Sbjct: 471 SSYPDMLNPEIRSWWSEKFSLKNYVGSTPWLYIWND 506


>tr|Q70AC6|Q70AC6_SOLLC Alpha glucosidase II OS=Solanum lycopersicum
GN=gluII PE=2 SV=1
Length = 921

Score = 272 bits (695), Expect = 7e-72
Identities = 119/156 (76%), Positives = 134/156 (85%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
SMPQ FATAYHQ RWNY+DE DVYNVD FDE DIPYDVLWLDIEHTDGK+YFT+D+ LF
Sbjct: 358 SMPQLFATAYHQCRWNYRDEEDVYNVDSKFDEHDIPYDVLWLDIEHTDGKKYFTWDRVLF 417

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P+P+EMQ+KL +KGRHMVTIVDPHIKRD+ Y + KEA KGYYVKD G+DYDGWCWPGS
Sbjct: 418 PNPEEMQKKLAAKGRHMVTIVDPHIKRDESYHIPKEALEKGYYVKDATGKDYDGWCWPGS 477

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
SSY D+L+PEIR WW+ KFS +YVGST LYIWND
Sbjct: 478 SSYTDLLNPEIRSWWSDKFSLDSYVGSTKYLYIWND 513


>tr|B5U8Z1|B5U8Z1_HORVU Alpha-glucosidase like protein OS=Hordeum
vulgare GN=Agl4 PE=2 SV=1
Length = 916

Score = 271 bits (694), Expect = 9e-72
Identities = 119/156 (76%), Positives = 132/156 (84%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
SMPQ FA AYHQ RWNY+DE DV VD FDE DIPYDVLWLDIEHTDGKRYFT+D+ F
Sbjct: 352 SMPQQFAVAYHQCRWNYRDEEDVGGVDAGFDEHDIPYDVLWLDIEHTDGKRYFTWDRSTF 411

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P+P+EMQ K+ KGR MVTIVDPH+KRD GY+LH+EAT+KGYYVKD G+DYDGWCWPGS
Sbjct: 412 PNPEEMQRKIADKGRKMVTIVDPHMKRDSGYYLHEEATAKGYYVKDASGKDYDGWCWPGS 471

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
SSY DML+PEIR WW KFSY NY GSTP+LYIWND
Sbjct: 472 SSYPDMLNPEIRDWWADKFSYQNYKGSTPTLYIWND 507


>tr|O24375|O24375_SOLTU Alpha-glucosidase OS=Solanum tuberosum PE=2
SV=1
Length = 919

Score = 271 bits (692), Expect = 2e-71
Identities = 118/156 (75%), Positives = 134/156 (85%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
SMPQ FATAYHQ RWNY+DE DVYNVD FDE DIPYDVLWLDIEHTDGK+YFT+D+ LF
Sbjct: 361 SMPQLFATAYHQCRWNYRDEEDVYNVDSKFDEHDIPYDVLWLDIEHTDGKKYFTWDRVLF 420

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P+P+EMQ+KL +KGRHMVTIVDPHIKRD+ Y + KEA KGYYVKD G+DYDGWCWPGS
Sbjct: 421 PNPEEMQKKLAAKGRHMVTIVDPHIKRDESYHIPKEALEKGYYVKDATGKDYDGWCWPGS 480

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
SSY D+L+PEI+ WW+ KFS +YVGST LYIWND
Sbjct: 481 SSYTDLLNPEIKSWWSDKFSLDSYVGSTKYLYIWND 516


>tr|Q10PY8|Q10PY8_ORYSJ Neutral alpha-glucosidase AB, putative,
expressed OS=Oryza sativa subsp. japonica
GN=LOC_Os03g11720 PE=4 SV=1
Length = 640

Score = 261 bits (668), Expect = 9e-69
Identities = 115/156 (73%), Positives = 129/156 (82%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
SMPQ FA AYHQ RWNY+DE DV VD FDE DIPYDVLWLDIEHTDGKRYFT+D F
Sbjct: 76 SMPQQFAVAYHQCRWNYRDEEDVAGVDSGFDEHDIPYDVLWLDIEHTDGKRYFTWDHSAF 135

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P+P+ MQ K+ KGR MVTIVDPHIKRD + LH+EAT+KGYYVKD G+D+DGWCWPG+
Sbjct: 136 PNPEVMQGKIADKGRKMVTIVDPHIKRDSSFHLHEEATAKGYYVKDATGKDFDGWCWPGA 195

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
SSY DML+PEIR+WW KFSY NY GSTP+LYIWND
Sbjct: 196 SSYPDMLNPEIREWWADKFSYENYKGSTPTLYIWND 231


>tr|Q0DTY9|Q0DTY9_ORYSJ Os03g0216600 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os03g0216600 PE=4 SV=1
Length = 862

Score = 261 bits (668), Expect = 9e-69
Identities = 115/156 (73%), Positives = 129/156 (82%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
SMPQ FA AYHQ RWNY+DE DV VD FDE DIPYDVLWLDIEHTDGKRYFT+D F
Sbjct: 298 SMPQQFAVAYHQCRWNYRDEEDVAGVDSGFDEHDIPYDVLWLDIEHTDGKRYFTWDHSAF 357

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P+P+ MQ K+ KGR MVTIVDPHIKRD + LH+EAT+KGYYVKD G+D+DGWCWPG+
Sbjct: 358 PNPEVMQGKIADKGRKMVTIVDPHIKRDSSFHLHEEATAKGYYVKDATGKDFDGWCWPGA 417

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
SSY DML+PEIR+WW KFSY NY GSTP+LYIWND
Sbjct: 418 SSYPDMLNPEIREWWADKFSYENYKGSTPTLYIWND 453


>tr|B8AQU2|B8AQU2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10536 PE=4 SV=1
Length = 879

Score = 261 bits (668), Expect = 9e-69
Identities = 115/156 (73%), Positives = 129/156 (82%)
Frame = -2

Query: 468 SMPQFFATAYHQSRWNYKDEADVYNVDDSFDEFDIPYDVLWLDIEHTDGKRYFTFDKHLF 289
SMPQ FA AYHQ RWNY+DE DV VD FDE DIPYDVLWLDIEHTDGKRYFT+D F
Sbjct: 315 SMPQQFAVAYHQCRWNYRDEEDVAGVDSGFDEHDIPYDVLWLDIEHTDGKRYFTWDHSAF 374

Query: 288 PDPKEMQEKLMSKGRHMVTIVDPHIKRDDGYFLHKEATSKGYYVKDIHGRDYDGWCWPGS 109
P+P+ MQ K+ KGR MVTIVDPHIKRD + LH+EAT+KGYYVKD G+D+DGWCWPG+
Sbjct: 375 PNPEVMQGKIADKGRKMVTIVDPHIKRDSSFHLHEEATAKGYYVKDATGKDFDGWCWPGA 434

Query: 108 SSYLDMLSPEIRKWWTGKFSYTNYVGSTPSLYIWND 1
SSY DML+PEIR+WW KFSY NY GSTP+LYIWND
Sbjct: 435 SSYPDMLNPEIREWWADKFSYENYKGSTPTLYIWND 470