BP918911
Clone id YMU001_000118_H09
Library
Length 299
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000118_H09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GAGCATGTCTCCAGGATGGGCTCACCCAATGCACACACAGAAACCCCTTCCATTGACATG
TTTGCAAGGGAGCCGTTGCTTAGCGTTGATAGATTCAGGTCGAGCCATTGATTCTCTACC
CATTCATATGCATATCCAAGCTTCAAGGTATCATAGCTATCTCTCACAGTCATCCTTCAC
AAGCTGTGCATTCTCATCGTAGAAGACGAACTCCGAATCAAGATAGTCCGGATCATCGAT
GTCATCTCTGCCGAGGCCTCTCCATACCTCCCACAGCCTGTCTATGTTCACATGGTGTA
■■Homology search results ■■ -
sp_hit_id P43309
Definition sp|P43309|PPO_MALDO Polyphenol oxidase, chloroplastic OS=Malus domestica
Align length 43
Score (bit) 59.3
E-value 3.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918911|Adiantum capillus-veneris mRNA, clone:
YMU001_000118_H09.
(299 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P43309|PPO_MALDO Polyphenol oxidase, chloroplastic OS=Malus d... 59 3e-11
sp|P43311|PPO_VITVI Polyphenol oxidase, chloroplastic OS=Vitis v... 61 9e-11
sp|Q9MB14|PPO2_IPOBA Polyphenol oxidase II, chloroplastic OS=Ipo... 56 3e-10
sp|Q06215|PPO_VICFA Polyphenol oxidase A1, chloroplastic OS=Vici... 55 3e-10
sp|Q08306|PPOD_SOLLC Polyphenol oxidase D, chloroplastic OS=Sola... 50 6e-09
sp|Q08303|PPOA_SOLLC Polyphenol oxidase A, chloroplastic OS=Sola... 52 1e-08
sp|Q08305|PPOC_SOLLC Polyphenol oxidase C, chloroplastic OS=Sola... 52 1e-08
sp|Q08304|PPOB_SOLLC Polyphenol oxidase B, chloroplastic OS=Sola... 50 5e-08
sp|Q08307|PPOE_SOLLC Polyphenol oxidase E, chloroplastic OS=Sola... 52 5e-08
sp|Q9ZP19|PPO1_IPOBA Polyphenol oxidase I, chloroplastic OS=Ipom... 51 5e-08
sp|Q06355|PPOB_SOLTU Catechol oxidase B, chloroplastic (Fragment... 51 1e-07
sp|Q08296|PPOF_SOLLC Polyphenol oxidase F, chloroplastic OS=Sola... 50 1e-07
sp|P43310|PPO_SPIOL Polyphenol oxidase, chloroplastic OS=Spinaci... 39 2e-06
sp|Q92396|TYRO_PODAN Tyrosinase OS=Podospora anserina GN=TYR PE=... 33 0.34
sp|P00440|TYRO_NEUCR Tyrosinase OS=Neurospora crassa GN=T PE=1 SV=5 33 0.34
sp|P33180|TYRO_RHIME Tyrosinase OS=Rhizobium meliloti GN=mepA PE... 31 2.2
sp|P80960|HCY2A_RAPTH Hemocyanin type 2 unit a OS=Rapana thomasi... 31 2.2
sp|Q29LT4|GSTCD_DROPS Glutathione S-transferase C-terminal domai... 31 2.2
sp|O61363|HCYG_OCTDO Hemocyanin G-type, units Oda to Odg OS=Octo... 30 2.9
sp|P12031|HCYB_HELPO Hemocyanin, beta-C chain unit D (Fragment) ... 30 3.8
sp|P12659|HCYA_OCTDO Hemocyanin A-type, units Ode to Odg (Fragme... 29 6.5
sp|Q48C87|GPMI_PSE14 2,3-bisphosphoglycerate-independent phospho... 29 6.5
sp|Q28VK7|ADEC1_JANSC Adenine deaminase 1 OS=Jannaschia sp. (str... 29 6.5
sp|Q9W5D0|Y34F_DROME Uncharacterized protein CG42248 OS=Drosophi... 29 8.4
sp|P81732|HC2C_MEGCR Hemocyanin 2-c chain OS=Megathura crenulata... 29 8.4
sp|Q9VJ34|GSTCD_DROME Glutathione S-transferase C-terminal domai... 29 8.4

>sp|P43309|PPO_MALDO Polyphenol oxidase, chloroplastic OS=Malus
domestica PE=2 SV=1
Length = 593

Score = 59.3 bits (142), Expect(2) = 3e-11
Identities = 24/43 (55%), Positives = 34/43 (79%), Gaps = 2/43 (4%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG--RDDIDDPDYLDSEFVFYDENAQLVK 175
HH N+DR+W +W+ LG R D+ D D+LDS F+FY+ENA+LV+
Sbjct: 360 HHSNVDRMWSIWKTLGGKRTDLTDSDWLDSGFLFYNENAELVR 402



Score = 28.5 bits (62), Expect(2) = 3e-11
Identities = 12/25 (48%), Positives = 16/25 (64%)
Frame = -1

Query: 176 RMTVRDSYDTLKLGYAYEWVENQWL 102
R+ VRD +T LGY Y+ V+ WL
Sbjct: 402 RVKVRDCLETKNLGYVYQDVDIPWL 426


>sp|P43311|PPO_VITVI Polyphenol oxidase, chloroplastic OS=Vitis
vinifera PE=1 SV=1
Length = 607

Score = 61.2 bits (147), Expect(2) = 9e-11
Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 6/50 (12%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG---RDDIDDPDYLDSEFVFYDENAQLVK---DDC 166
HH N+DR+W +W+ +G R D D D+LD+ FVFYDEN QLVK DC
Sbjct: 374 HHANVDRMWNIWKTIGGKNRKDFTDTDWLDATFVFYDENKQLVKVKVSDC 423



Score = 25.0 bits (53), Expect(2) = 9e-11
Identities = 15/49 (30%), Positives = 22/49 (44%)
Frame = -1

Query: 176 RMTVRDSYDTLKLGYAYEWVENQWLDLNLSTLSNGSLANMSMEGVSVCA 30
++ V D DT KL Y Y+ + WL N + + S GV+ A
Sbjct: 417 KVKVSDCVDTSKLRYQYQDIPIPWLPKNTKAKAK-TTTKSSKSGVAKAA 464


>sp|Q9MB14|PPO2_IPOBA Polyphenol oxidase II, chloroplastic
OS=Ipomoea batatas GN=co-2 PE=2 SV=2
Length = 588

Score = 55.8 bits (133), Expect(2) = 3e-10
Identities = 23/45 (51%), Positives = 31/45 (68%), Gaps = 4/45 (8%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG----RDDIDDPDYLDSEFVFYDENAQLVK 175
HH N+DR+W +W+ LG R D D D+LD+ F+FYDEN Q V+
Sbjct: 365 HHSNVDRMWTIWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAVR 409



Score = 28.9 bits (63), Expect(2) = 3e-10
Identities = 12/26 (46%), Positives = 16/26 (61%)
Frame = -1

Query: 176 RMTVRDSYDTLKLGYAYEWVENQWLD 99
R+ V D+ D KLGY YE+ WL+
Sbjct: 409 RVRVGDALDNQKLGYKYEFTNLPWLN 434


>sp|Q06215|PPO_VICFA Polyphenol oxidase A1, chloroplastic OS=Vicia
faba PE=1 SV=1
Length = 606

Score = 55.1 bits (131), Expect(2) = 3e-10
Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 2/43 (4%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG--RDDIDDPDYLDSEFVFYDENAQLVK 175
HH N+DRLW +W+ LG + D D D+L+S F+FYDEN LV+
Sbjct: 366 HHSNVDRLWYIWKTLGGKKHDFTDKDWLESGFLFYDENKNLVR 408



Score = 29.3 bits (64), Expect(2) = 3e-10
Identities = 14/27 (51%), Positives = 18/27 (66%)
Frame = -1

Query: 185 SL*RMTVRDSYDTLKLGYAYEWVENQW 105
+L R+ V+DS D KLGYAY+ V W
Sbjct: 405 NLVRVNVKDSLDIDKLGYAYQDVPIPW 431


>sp|Q08306|PPOD_SOLLC Polyphenol oxidase D, chloroplastic OS=Solanum
lycopersicum PE=3 SV=2
Length = 591

Score = 50.1 bits (118), Expect(2) = 6e-09
Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 2/38 (5%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG--RDDIDDPDYLDSEFVFYDEN 190
HH N+DR+W W+ G R DI D+L+SEF FYDEN
Sbjct: 365 HHSNVDRMWSEWKATGGKRTDITHKDWLNSEFFFYDEN 402



Score = 30.0 bits (66), Expect(2) = 6e-09
Identities = 14/41 (34%), Positives = 21/41 (51%)
Frame = -1

Query: 176 RMTVRDSYDTLKLGYAYEWVENQWLDLNLSTLSNGSLANMS 54
R+ VRD DT K+GY Y+ + W + T ++ N S
Sbjct: 407 RVKVRDCLDTKKMGYDYKPMRTPWRNFKPLTKASAGKVNTS 447


>sp|Q08303|PPOA_SOLLC Polyphenol oxidase A, chloroplastic OS=Solanum
lycopersicum PE=3 SV=2
Length = 630

Score = 51.6 bits (122), Expect(2) = 1e-08
Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 2/43 (4%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG--RDDIDDPDYLDSEFVFYDENAQLVK 175
HH N+DR+W W+ G R DI + D+L+SEF FYDEN K
Sbjct: 369 HHSNVDRMWNEWKATGGKRTDIQNKDWLNSEFFFYDENGNPFK 411



Score = 27.7 bits (60), Expect(2) = 1e-08
Identities = 12/39 (30%), Positives = 18/39 (46%)
Frame = -1

Query: 176 RMTVRDSYDTLKLGYAYEWVENQWLDLNLSTLSNGSLAN 60
++ VRD DT K+GY Y W + T ++ N
Sbjct: 411 KVRVRDCLDTKKMGYDYHATATPWRNFKPKTKASAGKVN 449


>sp|Q08305|PPOC_SOLLC Polyphenol oxidase C, chloroplastic OS=Solanum
lycopersicum PE=3 SV=1
Length = 626

Score = 51.6 bits (122), Expect(2) = 1e-08
Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 2/43 (4%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG--RDDIDDPDYLDSEFVFYDENAQLVK 175
HH N+DR+W W+ G R DI + D+L+SEF FYDEN K
Sbjct: 365 HHSNVDRMWNEWKATGGKRTDIQNKDWLNSEFFFYDENGNPFK 407



Score = 27.7 bits (60), Expect(2) = 1e-08
Identities = 12/39 (30%), Positives = 18/39 (46%)
Frame = -1

Query: 176 RMTVRDSYDTLKLGYAYEWVENQWLDLNLSTLSNGSLAN 60
++ VRD DT K+GY Y W + T ++ N
Sbjct: 407 KVRVRDCLDTKKMGYDYHATATPWRNFKPKTKASAGKVN 445


>sp|Q08304|PPOB_SOLLC Polyphenol oxidase B, chloroplastic OS=Solanum
lycopersicum PE=3 SV=1
Length = 596

Score = 50.1 bits (118), Expect(2) = 5e-08
Identities = 20/38 (52%), Positives = 28/38 (73%), Gaps = 2/38 (5%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG--RDDIDDPDYLDSEFVFYDEN 190
HH N+DR+W W+ +G R DI + D+L+SEF FYDE+
Sbjct: 370 HHGNVDRMWNEWKAIGGKRRDISEKDWLNSEFFFYDEH 407



Score = 26.9 bits (58), Expect(2) = 5e-08
Identities = 13/41 (31%), Positives = 20/41 (48%)
Frame = -1

Query: 176 RMTVRDSYDTLKLGYAYEWVENQWLDLNLSTLSNGSLANMS 54
R+ VRD DT K+GY Y + W + + ++ N S
Sbjct: 412 RVKVRDCLDTKKMGYDYAPMPTPWRNFKPKSKASVGKVNTS 452


>sp|Q08307|PPOE_SOLLC Polyphenol oxidase E, chloroplastic OS=Solanum
lycopersicum PE=3 SV=1
Length = 587

Score = 52.0 bits (123), Expect(2) = 5e-08
Identities = 21/38 (55%), Positives = 28/38 (73%), Gaps = 2/38 (5%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG--RDDIDDPDYLDSEFVFYDEN 190
HH N+DR+W W+ +G R D+ D D+L+SEF FYDEN
Sbjct: 362 HHANVDRMWNEWKLIGGKRRDLTDKDWLNSEFFFYDEN 399



Score = 25.0 bits (53), Expect(2) = 5e-08
Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
Frame = -1

Query: 176 RMTVRDSYDTLKLGYAYEWVENQWLDLN-LSTLSNGSLANMSMEGVS 39
R+ VRD D+ K+G+ Y + W + + S+G + S+ VS
Sbjct: 404 RVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKSSSGKVNTASIAPVS 450


>sp|Q9ZP19|PPO1_IPOBA Polyphenol oxidase I, chloroplastic OS=Ipomoea
batatas GN=co-1 PE=1 SV=1
Length = 496

Score = 50.8 bits (120), Expect(2) = 5e-08
Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 4/45 (8%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG----RDDIDDPDYLDSEFVFYDENAQLVK 175
HH N+DR+W +W+ L + D D D+L++ F+FYDEN Q VK
Sbjct: 273 HHSNVDRMWTIWQQLAGKPRKRDYTDSDWLNATFLFYDENGQAVK 317



Score = 26.2 bits (56), Expect(2) = 5e-08
Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%)
Frame = -1

Query: 176 RMTVRDSYDTLKLGYAYEWVENQWLDLN-LSTLSNGSLANMS 54
++ + DS D K+GY Y WLD + T G A+ S
Sbjct: 317 KVRIGDSLDNQKMGYKYAKTPLPWLDSKPVPTKKKGGYASKS 358


tr_hit_id Q56N25
Definition tr|Q56N25|Q56N25_PHYPA Polyphenol oxidase OS=Physcomitrella patens
Align length 42
Score (bit) 68.9
E-value 5.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918911|Adiantum capillus-veneris mRNA, clone:
YMU001_000118_H09.
(299 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q56N25|Q56N25_PHYPA Polyphenol oxidase OS=Physcomitrella pate... 69 5e-13
tr|A9SUP1|A9SUP1_PHYPA Predicted protein OS=Physcomitrella paten... 69 5e-13
tr|A7R963|A7R963_VITVI Chromosome undetermined scaffold_3388, wh... 68 9e-13
tr|A7R149|A7R149_VITVI Chromosome undetermined scaffold_337, who... 68 9e-13
tr|A5BPY3|A5BPY3_VITVI Putative uncharacterized protein OS=Vitis... 68 2e-12
tr|Q9FRX6|Q9FRX6_ANTMA Aureusidin synthase OS=Antirrhinum majus ... 64 2e-12
tr|Q8RVE0|Q8RVE0_ORYSJ Putative polyphenol oxidase (Putative unc... 64 4e-12
tr|Q1HBJ1|Q1HBJ1_9ERIC Polyphenol oxidase OS=Camellia ptilophyll... 66 6e-12
tr|A7J0M1|A7J0M1_9ROSA Putative polyphenol oxidase (Fragment) OS... 61 6e-12
tr|A2Q4Q3|A2Q4Q3_MEDTR Tyrosinase OS=Medicago truncatula GN=MtrD... 60 7e-12
tr|B3WFP2|B3WFP2_TAROF Polyphenol oxidase OS=Taraxacum officinal... 63 7e-12
tr|A7J0M9|A7J0M9_SPICA Putative polyphenol oxidase (Fragment) OS... 61 7e-12
tr|A9U439|A9U439_PHYPA Predicted protein OS=Physcomitrella paten... 69 9e-12
tr|A7J0N0|A7J0N0_SPIDE Putative polyphenol oxidase (Fragment) OS... 60 9e-12
tr|Q1HBJ0|Q1HBJ0_CAMSI Polyphenol oxidase OS=Camellia sinensis v... 65 1e-11
tr|A7J0K9|A7J0K9_9ROSA Putative polyphenol oxidase (Fragment) OS... 60 1e-11
tr|B2BX66|B2BX66_TAROF Chloroplast polyphenol oxidase OS=Taraxac... 59 2e-11
tr|A7J0K4|A7J0K4_9ROSA Putative polyphenol oxidase (Fragment) OS... 61 2e-11
tr|A7J0K5|A7J0K5_ADEFA Putative polyphenol oxidase (Fragment) OS... 60 3e-11
tr|A2Q4Q4|A2Q4Q4_MEDTR Tyrosinase OS=Medicago truncatula GN=MtrD... 60 3e-11
tr|B6UV38|B6UV38_CAMSI Polyphenol oxidase OS=Camellia sinensis G... 63 3e-11
tr|Q84YI1|Q84YI1_TRIPR Polyphenol oxidase OS=Trifolium pratense ... 64 4e-11
tr|A7J0L9|A7J0L9_9ROSA Putative polyphenol oxidase (Fragment) OS... 60 5e-11
tr|Q7Y249|Q7Y249_MEDSA Polyphenol oxidase OS=Medicago sativa GN=... 60 6e-11
tr|A7J0K8|A7J0K8_9ROSA Putative polyphenol oxidase (Fragment) OS... 63 8e-11
tr|A7J0M3|A7J0M3_9ROSA Putative polyphenol oxidase (Fragment) OS... 57 8e-11
tr|B2CKK8|B2CKK8_FRAAN Polyphenol oxidase (Fragment) OS=Fragaria... 61 8e-11
tr|A6YS04|A6YS04_CAMSI Polyphenol oxidase OS=Camellia sinensis P... 62 1e-10
tr|A7J0N1|A7J0N1_VAUCA Putative polyphenol oxidase (Fragment) OS... 59 1e-10
tr|A7J0L7|A7J0L7_9ROSA Putative polyphenol oxidase (Fragment) OS... 59 1e-10

>tr|Q56N25|Q56N25_PHYPA Polyphenol oxidase OS=Physcomitrella patens
GN=PPO PE=2 SV=1
Length = 536

Score = 68.9 bits (167), Expect(2) = 5e-13
Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 2/42 (4%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG--RDDIDDPDYLDSEFVFYDENAQLV 178
HH NIDRLWEVW+G+G DI DPDYL S+FVFYDEN +LV
Sbjct: 297 HHANIDRLWEVWKGMGGRHKDISDPDYLKSQFVFYDENKRLV 338



Score = 28.5 bits (62), Expect(2) = 5e-13
Identities = 13/35 (37%), Positives = 18/35 (51%)
Frame = -1

Query: 140 LGYAYEWVENQWLDLNLSTLSNGSLANMSMEGVSV 36
L Y Y+ V N W++ +S S+ M M G SV
Sbjct: 351 LRYGYQKVPNPWMNPKAGGMSTASVDGMDMSGQSV 385


>tr|A9SUP1|A9SUP1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_215905 PE=4 SV=1
Length = 536

Score = 68.9 bits (167), Expect(2) = 5e-13
Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 2/42 (4%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG--RDDIDDPDYLDSEFVFYDENAQLV 178
HH NIDRLWEVW+G+G DI DPDYL S+FVFYDEN +LV
Sbjct: 297 HHANIDRLWEVWKGMGGRHKDISDPDYLKSQFVFYDENKRLV 338



Score = 28.5 bits (62), Expect(2) = 5e-13
Identities = 13/35 (37%), Positives = 18/35 (51%)
Frame = -1

Query: 140 LGYAYEWVENQWLDLNLSTLSNGSLANMSMEGVSV 36
L Y Y+ V N W++ +S S+ M M G SV
Sbjct: 351 LRYGYQKVPNPWMNPKAGGMSTASVDGMDMSGQSV 385


>tr|A7R963|A7R963_VITVI Chromosome undetermined scaffold_3388, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00012737001 PE=4 SV=1
Length = 584

Score = 67.8 bits (164), Expect(2) = 9e-13
Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 2/43 (4%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG--RDDIDDPDYLDSEFVFYDENAQLVK 175
HH N+DR+W VW+GLG R D DPD+LD+ FVFYDENAQLV+
Sbjct: 369 HHSNVDRMWTVWKGLGGKRKDFTDPDWLDAGFVFYDENAQLVR 411



Score = 28.9 bits (63), Expect(2) = 9e-13
Identities = 13/25 (52%), Positives = 16/25 (64%)
Frame = -1

Query: 176 RMTVRDSYDTLKLGYAYEWVENQWL 102
R+ VRD D KL YAY+ V+ WL
Sbjct: 411 RVKVRDCLDPTKLRYAYQEVDIPWL 435


>tr|A7R149|A7R149_VITVI Chromosome undetermined scaffold_337, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00011776001 PE=4 SV=1
Length = 584

Score = 67.8 bits (164), Expect(2) = 9e-13
Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 2/43 (4%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG--RDDIDDPDYLDSEFVFYDENAQLVK 175
HH N+DR+W VW+GLG R D DPD+LD+ FVFYDENAQLV+
Sbjct: 369 HHSNVDRMWTVWKGLGGKRKDFTDPDWLDAGFVFYDENAQLVR 411



Score = 28.9 bits (63), Expect(2) = 9e-13
Identities = 13/25 (52%), Positives = 16/25 (64%)
Frame = -1

Query: 176 RMTVRDSYDTLKLGYAYEWVENQWL 102
R+ VRD D KL YAY+ V+ WL
Sbjct: 411 RVKVRDCLDPTKLRYAYQEVDIPWL 435


>tr|A5BPY3|A5BPY3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_006012 PE=4 SV=1
Length = 601

Score = 67.8 bits (164), Expect(2) = 2e-12
Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 2/43 (4%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG--RDDIDDPDYLDSEFVFYDENAQLVK 175
HH N+DR+W VW+GLG R D DPD+LD+ FVFYDENAQLV+
Sbjct: 369 HHSNVDRMWTVWKGLGGKRKDFTDPDWLDAGFVFYDENAQLVR 411



Score = 28.1 bits (61), Expect(2) = 2e-12
Identities = 13/25 (52%), Positives = 15/25 (60%)
Frame = -1

Query: 176 RMTVRDSYDTLKLGYAYEWVENQWL 102
R+ VRD D KL YAY V+ WL
Sbjct: 411 RVKVRDCLDPTKLRYAYHEVDIPWL 435


>tr|Q9FRX6|Q9FRX6_ANTMA Aureusidin synthase OS=Antirrhinum majus
GN=AmAS1 PE=2 SV=1
Length = 562

Score = 64.3 bits (155), Expect(2) = 2e-12
Identities = 25/44 (56%), Positives = 35/44 (79%), Gaps = 3/44 (6%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG---RDDIDDPDYLDSEFVFYDENAQLVK 175
HH N+DR+W +W+ LG R D+ DPD+LD+ FVFYDENA++V+
Sbjct: 334 HHSNVDRMWSIWKTLGGPRRTDLTDPDFLDASFVFYDENAEMVR 377



Score = 31.2 bits (69), Expect(2) = 2e-12
Identities = 14/26 (53%), Positives = 17/26 (65%)
Frame = -1

Query: 176 RMTVRDSYDTLKLGYAYEWVENQWLD 99
R+ VRD D KLGY Y+ VE WL+
Sbjct: 377 RVKVRDCLDEKKLGYVYQDVEIPWLN 402


>tr|Q8RVE0|Q8RVE0_ORYSJ Putative polyphenol oxidase (Putative
uncharacterized protein) OS=Oryza sativa subsp. japonica
GN=P0684C02.4 PE=4 SV=1
Length = 575

Score = 64.3 bits (155), Expect(2) = 4e-12
Identities = 27/42 (64%), Positives = 34/42 (80%), Gaps = 1/42 (2%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLGR-DDIDDPDYLDSEFVFYDENAQLVK 175
HH NIDRLW+VWR G+ +D DPD+LDS F+FYDE A+LV+
Sbjct: 356 HHANIDRLWDVWRSNGKGEDFTDPDWLDSSFLFYDEEARLVR 397



Score = 30.0 bits (66), Expect(2) = 4e-12
Identities = 16/34 (47%), Positives = 17/34 (50%)
Frame = -1

Query: 176 RMTVRDSYDTLKLGYAYEWVENQWLDLNLSTLSN 75
R+TVRD D KL Y Y V WLD T N
Sbjct: 397 RITVRDVLDMDKLRYTYRGVGLPWLDARPPTTPN 430


>tr|Q1HBJ1|Q1HBJ1_9ERIC Polyphenol oxidase OS=Camellia ptilophylla
GN=ppo PE=4 SV=1
Length = 595

Score = 65.9 bits (159), Expect(2) = 6e-12
Identities = 28/42 (66%), Positives = 34/42 (80%), Gaps = 2/42 (4%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG--RDDIDDPDYLDSEFVFYDENAQLV 178
HH N+DR+W VW+ LG R+D DPD+L+SEF FYDENAQLV
Sbjct: 365 HHANVDRIWTVWKTLGGKRNDFKDPDWLNSEFTFYDENAQLV 406



Score = 28.1 bits (61), Expect(2) = 6e-12
Identities = 12/23 (52%), Positives = 16/23 (69%)
Frame = -1

Query: 167 VRDSYDTLKLGYAYEWVENQWLD 99
V++S D KLGY Y+ VE WL+
Sbjct: 410 VKESLDHRKLGYVYQDVEIPWLN 432


>tr|A7J0M1|A7J0M1_9ROSA Putative polyphenol oxidase (Fragment)
OS=Physocarpus capitatus GN=ppo PE=4 SV=1
Length = 451

Score = 60.8 bits (146), Expect(2) = 6e-12
Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 2/43 (4%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG--RDDIDDPDYLDSEFVFYDENAQLVK 175
HH N+DRLW +W+ LG R DI D D+LDS F+FY+ENA+LV+
Sbjct: 276 HHSNVDRLWSIWKTLGGKRTDITDSDWLDSGFLFYNENAELVR 318



Score = 33.1 bits (74), Expect(2) = 6e-12
Identities = 14/26 (53%), Positives = 19/26 (73%)
Frame = -1

Query: 176 RMTVRDSYDTLKLGYAYEWVENQWLD 99
R+ VRDS ++ KLGY Y+ V+ WLD
Sbjct: 318 RVKVRDSLESKKLGYVYQDVDIPWLD 343


>tr|A2Q4Q3|A2Q4Q3_MEDTR Tyrosinase OS=Medicago truncatula
GN=MtrDRAFT_AC157507g12v2 PE=4 SV=1
Length = 607

Score = 60.1 bits (144), Expect(2) = 7e-12
Identities = 27/43 (62%), Positives = 31/43 (72%), Gaps = 2/43 (4%)
Frame = -3

Query: 297 HHVNIDRLWEVWRGLG--RDDIDDPDYLDSEFVFYDENAQLVK 175
HH NIDR W VW+ LG R D D D+L+SEF+FYDEN LVK
Sbjct: 369 HHSNIDRFWSVWKTLGGKRKDFKDKDWLESEFLFYDENKNLVK 411



Score = 33.5 bits (75), Expect(2) = 7e-12
Identities = 14/29 (48%), Positives = 21/29 (72%)
Frame = -1

Query: 185 SL*RMTVRDSYDTLKLGYAYEWVENQWLD 99
+L ++ V+DS DT KLGY Y+ V+ WL+
Sbjct: 408 NLVKVKVKDSLDTKKLGYVYQDVDTPWLN 436