BP918916
Clone id YMU001_000119_A03
Library
Length 321
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000119_A03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATCCACAAATGATTGCTCTAGAACTACCTCGGGAAGATCTGGCTCTGGAAAGTATCGATA
ATCTGCTAGACCTTCTTTGAGCCGCATGGTGATAGTGCGTTGTGATCCTTCTTCCCATAG
CCGTGTCTCCTGAACAATAAAGGCAGGTTGCCCTTCTCCATGTAATGAGACCTGTCTTGA
TATCTCGAACTCTATAGCACGCTGCATTGCTGAAAAAGAATTCATATGATTCATTTCAAC
CTTTGTCCCAAACTTTTCATCACCCTTCTTCCTAACAGAGATGTTCACATCGCATCGCAT
AGATCCCTCCTGCATATTGCC
■■Homology search results ■■ -
sp_hit_id Q8YX22
Definition sp|Q8YX22|GATB_ANASP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anabaena sp. (strain PCC 7120)
Align length 104
Score (bit) 144.0
E-value 2.0e-34
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918916|Adiantum capillus-veneris mRNA, clone:
YMU001_000119_A03.
(321 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8YX22|GATB_ANASP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 144 2e-34
sp|P74215|GATB_SYNY3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 143 3e-34
sp|Q3M629|GATB_ANAVT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 143 3e-34
sp|B0BZQ6|GATB_ACAM1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 141 9e-34
sp|Q2JXB3|GATB_SYNJA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 140 1e-33
sp|Q5N294|GATB_SYNP6 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 139 4e-33
sp|Q31S19|GATB_SYNE7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 139 6e-33
sp|Q2JNH3|GATB_SYNJB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 138 7e-33
sp|Q10XY9|GATB_TRIEI Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 137 2e-32
sp|Q8DGC4|GATB_THEEB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 137 2e-32
sp|Q3AVV7|GATB_SYNS9 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 133 2e-31
sp|Q3AGQ3|GATB_SYNSC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 133 3e-31
sp|Q7U3S3|GATB_SYNPX Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 133 3e-31
sp|Q7TUK1|GATB_PROMM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 130 2e-30
sp|A2CDJ8|GATB_PROM3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 129 3e-30
sp|A5GPE6|GATB_SYNPW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 129 4e-30
sp|A2BU03|GATB_PROM5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 129 4e-30
sp|Q3AD35|GATB_CARHZ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 128 8e-30
sp|Q7NI42|GATB_GLOVI Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 127 2e-29
sp|A2BNH6|GATB_PROMS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 127 2e-29
sp|Q31DD5|GATB_PROM9 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 127 2e-29
sp|Q7V3M7|GATB_PROMP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 126 4e-29
sp|Q46I09|GATB_PROMT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 125 8e-29
sp|A2BZG6|GATB_PROM1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 125 8e-29
sp|Q7VEG1|GATB_PROMA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 123 3e-28
sp|P61341|GATB_BDEBA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 120 2e-27
sp|Q2IH95|GATB_ANADE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 117 1e-26
sp|Q0ACB6|GATB_ALHEH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 117 1e-26
sp|Q055U6|GATB_LEPBL Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 116 3e-26
sp|Q04PH9|GATB_LEPBJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 116 3e-26

>sp|Q8YX22|GATB_ANASP Aspartyl/glutamyl-tRNA(Asn/Gln)
amidotransferase subunit B OS=Anabaena sp. (strain PCC
7120) GN=gatB PE=3 SV=1
Length = 491

Score = 144 bits (362), Expect = 2e-34
Identities = 70/104 (67%), Positives = 85/104 (81%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGS+RCDVNISVR G EKFGTKVE+ +MNSFSA+Q+AIE EI RQ+ G+
Sbjct: 202 GNMQEGSLRCDVNISVRPVGQEKFGTKVEIKNMNSFSAIQKAIEHEIERQIEAIESGEK- 260

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQS 10
I+QETRLWEEGSQRTI+MR+KEG +DYRYFPEPDL + + ++
Sbjct: 261 -IIQETRLWEEGSQRTISMRIKEGSSDYRYFPEPDLAPIEVTEA 303


>sp|P74215|GATB_SYNY3 Aspartyl/glutamyl-tRNA(Asn/Gln)
amidotransferase subunit B OS=Synechocystis sp. (strain
PCC 6803) GN=gatB PE=3 SV=2
Length = 495

Score = 143 bits (360), Expect = 3e-34
Identities = 69/103 (66%), Positives = 85/103 (82%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGS+RCDVNISVR G ++FGTKVE+ +MNSFSA+Q+AIE+EI RQ+ +G+
Sbjct: 202 GNMQEGSLRCDVNISVRPVGQKEFGTKVEIKNMNSFSAIQKAIEYEIERQIKAIADGEE- 260

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQ 13
I QETRLWEEGSQRTI+MR KEG +DYRYFPEPDLP + + +
Sbjct: 261 -IYQETRLWEEGSQRTISMRKKEGSSDYRYFPEPDLPPLEVSE 302


>sp|Q3M629|GATB_ANAVT Aspartyl/glutamyl-tRNA(Asn/Gln)
amidotransferase subunit B OS=Anabaena variabilis
(strain ATCC 29413 / PCC 7937) GN=gatB PE=3 SV=1
Length = 491

Score = 143 bits (360), Expect = 3e-34
Identities = 70/104 (67%), Positives = 84/104 (80%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGS+RCDVNISVR G EKFGTKVE+ +MNSFSA+Q+AIE EI RQ+ G+
Sbjct: 202 GNMQEGSLRCDVNISVRPVGQEKFGTKVEIKNMNSFSAIQKAIEHEIERQIEAIESGEK- 260

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQS 10
I+QETRLWEEGSQRTI+MR KEG +DYRYFPEPDL + + ++
Sbjct: 261 -IIQETRLWEEGSQRTISMRTKEGSSDYRYFPEPDLAPIEVSEA 303


>sp|B0BZQ6|GATB_ACAM1 Aspartyl/glutamyl-tRNA(Asn/Gln)
amidotransferase subunit B OS=Acaryochloris marina
(strain MBIC 11017) GN=gatB PE=3 SV=1
Length = 494

Score = 141 bits (356), Expect = 9e-34
Identities = 68/106 (64%), Positives = 86/106 (81%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGS+RCDVNISVR +G ++FGTKVE+ +MNSFSA+ RAI++EI+RQ+ G+P
Sbjct: 202 GNMQEGSLRCDVNISVRPRGQKEFGTKVEIKNMNSFSAIHRAIDYEIARQIEAIETGEP- 260

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQSFV 4
I+QETRLWEEG+QRTI MR KEG +DYRYFPEPDL + + S +
Sbjct: 261 -IIQETRLWEEGAQRTIGMRSKEGSSDYRYFPEPDLTPIEVAPSLL 305


>sp|Q2JXB3|GATB_SYNJA Aspartyl/glutamyl-tRNA(Asn/Gln)
amidotransferase subunit B OS=Synechococcus sp. (strain
JA-3-3Ab) GN=gatB PE=3 SV=1
Length = 490

Score = 140 bits (354), Expect = 1e-33
Identities = 69/99 (69%), Positives = 81/99 (81%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GN+QEGS+RCDVNISVR G FGTKVE+ +MNSF+A+QRAIE+E +RQV G+P
Sbjct: 198 GNLQEGSLRCDVNISVRPLGSPTFGTKVEIKNMNSFNAIQRAIEYEFNRQVKAVEAGEP- 256

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEV 25
IVQETRLWEE SQRTI+MR KEG +DYRYFPEPDLP +
Sbjct: 257 -IVQETRLWEENSQRTISMRKKEGSSDYRYFPEPDLPPI 294


>sp|Q5N294|GATB_SYNP6 Aspartyl/glutamyl-tRNA(Asn/Gln)
amidotransferase subunit B OS=Synechococcus sp. (strain
ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gatB PE=3 SV=1
Length = 494

Score = 139 bits (350), Expect = 4e-33
Identities = 68/104 (65%), Positives = 83/104 (79%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNM EGS+RCDVNIS+R KG EKFGTKVE+ +MNSF+A+QRAIEFEI RQ+ G+P
Sbjct: 202 GNMAEGSLRCDVNISIRPKGTEKFGTKVEIKYMNSFNAIQRAIEFEIERQIRCLETGEP- 260

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQS 10
IVQETRLW+EG Q T +MR KEG +DYRYFPEPDL + + ++
Sbjct: 261 -IVQETRLWDEGKQVTKSMRSKEGSSDYRYFPEPDLGPIEVSET 303


>sp|Q31S19|GATB_SYNE7 Aspartyl/glutamyl-tRNA(Asn/Gln)
amidotransferase subunit B OS=Synechococcus elongatus
(strain PCC 7942) GN=gatB PE=3 SV=1
Length = 494

Score = 139 bits (349), Expect = 6e-33
Identities = 68/104 (65%), Positives = 83/104 (79%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNM EGS+RCDVNIS+R KG EKFGTKVE+ +MNSF+A+QRAIEFEI RQ+ G+P
Sbjct: 202 GNMAEGSLRCDVNISIRPKGTEKFGTKVEIKNMNSFNAIQRAIEFEIERQIRCLETGEP- 260

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQS 10
IVQETRLW+EG Q T +MR KEG +DYRYFPEPDL + + ++
Sbjct: 261 -IVQETRLWDEGKQVTKSMRSKEGSSDYRYFPEPDLGPIEVSET 303


>sp|Q2JNH3|GATB_SYNJB Aspartyl/glutamyl-tRNA(Asn/Gln)
amidotransferase subunit B OS=Synechococcus sp. GN=gatB
PE=3 SV=1
Length = 490

Score = 138 bits (348), Expect = 7e-33
Identities = 68/99 (68%), Positives = 81/99 (81%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GN+QEGS+RCDVNISVR G + FGTKVE+ +MNSF+A+QRAIE+E +RQV G+
Sbjct: 198 GNLQEGSLRCDVNISVRPLGSQTFGTKVEIKNMNSFNAIQRAIEYEFNRQVKAVEAGER- 256

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEV 25
IVQETRLWEE SQRTI+MR KEG +DYRYFPEPDLP +
Sbjct: 257 -IVQETRLWEENSQRTISMRKKEGSSDYRYFPEPDLPPI 294


>sp|Q10XY9|GATB_TRIEI Aspartyl/glutamyl-tRNA(Asn/Gln)
amidotransferase subunit B OS=Trichodesmium erythraeum
(strain IMS101) GN=gatB PE=3 SV=1
Length = 494

Score = 137 bits (345), Expect = 2e-32
Identities = 66/107 (61%), Positives = 83/107 (77%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGS+RCDVN+SVR G ++FGTKVE+ +MNSFSA+QRAIE+EI RQ G+
Sbjct: 202 GNMQEGSLRCDVNVSVRPVGQKEFGTKVEIKNMNSFSAIQRAIEYEIERQTEAIETGEK- 260

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQSFVD 1
I+QETRLWEE SQ T++MR KEG +DYRYFPEPD+P + + +D
Sbjct: 261 -IIQETRLWEEASQCTVSMRTKEGSSDYRYFPEPDIPPIEVSTQQLD 306


>sp|Q8DGC4|GATB_THEEB Aspartyl/glutamyl-tRNA(Asn/Gln)
amidotransferase subunit B OS=Thermosynechococcus
elongatus (strain BP-1) GN=gatB PE=3 SV=1
Length = 500

Score = 137 bits (345), Expect = 2e-32
Identities = 71/105 (67%), Positives = 83/105 (79%), Gaps = 2/105 (1%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGS+RCDVNISVR G FGTKVE+ +MNSFSA+QRAI++EI RQV+ G+P
Sbjct: 206 GNMQEGSLRCDVNISVRPVGSNTFGTKVEIKNMNSFSAIQRAIDYEIERQVAALKAGEP- 264

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLP--EVVLEQ 13
IVQETRLW+E +Q T TMR+KEG +DYRYFPEPDL EV EQ
Sbjct: 265 -IVQETRLWDEATQETRTMRVKEGSSDYRYFPEPDLGPIEVTAEQ 308


tr_hit_id A7NXK2
Definition tr|A7NXK2|A7NXK2_VITVI Chromosome chr5 scaffold_2, whole genome shotgun sequence OS=Vitis vinifera
Align length 106
Score (bit) 166.0
E-value 7.0e-40
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918916|Adiantum capillus-veneris mRNA, clone:
YMU001_000119_A03.
(321 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7NXK2|A7NXK2_VITVI Chromosome chr5 scaffold_2, whole genome ... 166 7e-40
tr|A9TWD9|A9TWD9_PHYPA Predicted protein OS=Physcomitrella paten... 165 9e-40
tr|Q2R2Z0|Q2R2Z0_ORYSJ Aspartyl/glutamyl-tRNA amidotransferase s... 162 8e-39
tr|Q0IS96|Q0IS96_ORYSJ Os11g0544800 protein (Fragment) OS=Oryza ... 162 8e-39
tr|A2ZF53|A2ZF53_ORYSI Putative uncharacterized protein OS=Oryza... 162 8e-39
tr|Q9LP72|Q9LP72_ARATH T1N15.14 OS=Arabidopsis thaliana PE=4 SV=1 159 9e-38
tr|Q9FV81|Q9FV81_ARATH Glu-tRNA(Gln) amidotransferase subunit B ... 159 9e-38
tr|Q3ECU6|Q3ECU6_ARATH Uncharacterized protein At1g48520.2 OS=Ar... 159 9e-38
tr|Q3E7E0|Q3E7E0_ARATH Uncharacterized protein At1g48520.3 OS=Ar... 159 9e-38
tr|B7KGN0|B7KGN0_9CHRO Glutamyl-tRNA(Gln) amidotransferase, B su... 150 3e-35
tr|B0JN51|B0JN51_MICAN Glutamyl-tRNA(Gln) amidotransferase subun... 149 7e-35
tr|A8YDD4|A8YDD4_MICAE GatB protein OS=Microcystis aeruginosa PC... 149 9e-35
tr|B4W234|B4W234_9CYAN Glutamyl-tRNA(Gln) and/or aspartyl-tRNA(A... 146 6e-34
tr|B4B767|B4B767_9CHRO Glutamyl-tRNA(Gln) amidotransferase, B su... 144 3e-33
tr|B5VU68|B5VU68_SPIMA Glutamyl-tRNA(Gln) amidotransferase, B su... 142 6e-33
tr|A0YSA4|A0YSA4_9CYAN Aspartyl/glutamyl-tRNA amidotransferase s... 141 2e-32
tr|A0ZEK8|A0ZEK8_NODSP Aspartyl/glutamyl-tRNA amidotransferase s... 140 3e-32
tr|B1XKN8|B1XKN8_SYNP2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotran... 139 5e-32
tr|B4WQY6|B4WQY6_9SYNE Glutamyl-tRNA(Gln) and/or aspartyl-tRNA(A... 138 1e-31
tr|Q4C0R7|Q4C0R7_CROWT Glutamyl-tRNA(Gln) amidotransferase B sub... 137 2e-31
tr|B8HPE9|B8HPE9_9CHRO Glutamyl-tRNA(Gln) amidotransferase, B su... 137 2e-31
tr|B1WYK7|B1WYK7_CYAA5 Glutamyl-tRNA (Gln) amidotransferase subu... 137 3e-31
tr|A3IW12|A3IW12_9CHRO Aspartyl/glutamyl-tRNA amidotransferase s... 137 3e-31
tr|B2J8F0|B2J8F0_NOSP7 Glutamyl-tRNA(Gln) amidotransferase, B su... 136 6e-31
tr|A4S450|A4S450_OSTLU Predicted protein OS=Ostreococcus lucimar... 134 2e-30
tr|B7K293|B7K293_SYNP8 Glutamyl-tRNA(Gln) amidotransferase, B su... 134 2e-30
tr|B4C2D3|B4C2D3_9CHRO Glutamyl-tRNA(Gln) amidotransferase, B su... 134 2e-30
tr|Q061R3|Q061R3_9SYNE Aspartyl/glutamyl-tRNA amidotransferase s... 134 3e-30
tr|A3Z3F2|A3Z3F2_9SYNE Glutamyl-tRNA (Gln) amidotransferase subu... 133 4e-30
tr|Q05VF1|Q05VF1_9SYNE Aspartyl/glutamyl-tRNA amidotransferase s... 133 5e-30

>tr|A7NXK2|A7NXK2_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020369001
PE=4 SV=1
Length = 555

Score = 166 bits (419), Expect = 7e-40
Identities = 78/106 (73%), Positives = 92/106 (86%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGS+RCDVN+SVR G +FGTKVE+ ++NSFSAM RAI+FEISRQVSLH +GQ
Sbjct: 261 GNMQEGSLRCDVNVSVRPIGQLEFGTKVEIKNLNSFSAMNRAIDFEISRQVSLHSQGQSD 320

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQSFV 4
IVQETRLWEEG Q+T+TMR KEGL+DYRYFPEPDLPEV+L + +V
Sbjct: 321 QIVQETRLWEEGGQKTVTMRKKEGLSDYRYFPEPDLPEVILTEDYV 366


>tr|A9TWD9|A9TWD9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_226103 PE=4 SV=1
Length = 562

Score = 165 bits (418), Expect = 9e-40
Identities = 81/107 (75%), Positives = 94/107 (87%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGSMRCDVNIS+R KG E+FGTKVE+ +MNSFSAMQ+AIEFE+ RQ++L EG+
Sbjct: 271 GNMQEGSMRCDVNISIRPKGREQFGTKVEIKNMNSFSAMQKAIEFEMDRQIALLEEGER- 329

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQSFVD 1
I QETRLWEEGSQ+TI+MR KEGLADYRYFPEPDLPEVVL Q ++D
Sbjct: 330 -IKQETRLWEEGSQQTISMRSKEGLADYRYFPEPDLPEVVLSQEYID 375


>tr|Q2R2Z0|Q2R2Z0_ORYSJ Aspartyl/glutamyl-tRNA amidotransferase
subunit B, putative, expressed OS=Oryza sativa subsp.
japonica GN=LOC_Os11g34210 PE=2 SV=1
Length = 544

Score = 162 bits (410), Expect = 8e-39
Identities = 77/107 (71%), Positives = 89/107 (83%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGS+RCDVN+SVR G FGTKVE+ +MNSFSA+ RAI++EISRQ+ LH EGQ
Sbjct: 249 GNMQEGSLRCDVNVSVRPIGQSNFGTKVEIKNMNSFSAISRAIDYEISRQILLHKEGQAD 308

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQSFVD 1
IVQETRLW+E SQ+T TMR KEGLADYRYFPEPDLPEVVL ++D
Sbjct: 309 QIVQETRLWDESSQKTFTMRKKEGLADYRYFPEPDLPEVVLTSEYID 355


>tr|Q0IS96|Q0IS96_ORYSJ Os11g0544800 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os11g0544800 PE=4 SV=1
Length = 553

Score = 162 bits (410), Expect = 8e-39
Identities = 77/107 (71%), Positives = 89/107 (83%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGS+RCDVN+SVR G FGTKVE+ +MNSFSA+ RAI++EISRQ+ LH EGQ
Sbjct: 258 GNMQEGSLRCDVNVSVRPIGQSNFGTKVEIKNMNSFSAISRAIDYEISRQILLHKEGQAD 317

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQSFVD 1
IVQETRLW+E SQ+T TMR KEGLADYRYFPEPDLPEVVL ++D
Sbjct: 318 QIVQETRLWDESSQKTFTMRKKEGLADYRYFPEPDLPEVVLTSEYID 364


>tr|A2ZF53|A2ZF53_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_36412 PE=4 SV=1
Length = 544

Score = 162 bits (410), Expect = 8e-39
Identities = 77/107 (71%), Positives = 89/107 (83%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGS+RCDVN+SVR G FGTKVE+ +MNSFSA+ RAI++EISRQ+ LH EGQ
Sbjct: 249 GNMQEGSLRCDVNVSVRPIGQSNFGTKVEIKNMNSFSAISRAIDYEISRQILLHKEGQAD 308

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQSFVD 1
IVQETRLW+E SQ+T TMR KEGLADYRYFPEPDLPEVVL ++D
Sbjct: 309 QIVQETRLWDESSQKTFTMRKKEGLADYRYFPEPDLPEVVLTSEYID 355


>tr|Q9LP72|Q9LP72_ARATH T1N15.14 OS=Arabidopsis thaliana PE=4 SV=1
Length = 618

Score = 159 bits (401), Expect = 9e-38
Identities = 74/107 (69%), Positives = 91/107 (85%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGS+RCDVNIS+R G +FGTKVE+ ++N+FSA+ RAI+FEISRQ L+ +G+
Sbjct: 346 GNMQEGSLRCDVNISIRPIGQAEFGTKVEIKNLNAFSAISRAIDFEISRQALLYNQGKAD 405

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQSFVD 1
IV ETRLWEEG+Q+T+TMR KEGLADYRYFPEPDLPEV+L Q +VD
Sbjct: 406 QIVTETRLWEEGAQKTVTMRKKEGLADYRYFPEPDLPEVILTQEYVD 452


>tr|Q9FV81|Q9FV81_ARATH Glu-tRNA(Gln) amidotransferase subunit B
(Putative uncharacterized protein At1g48520)
(At1g48520/T1N15_12) OS=Arabidopsis thaliana
GN=At1g48520 PE=2 SV=1
Length = 550

Score = 159 bits (401), Expect = 9e-38
Identities = 74/107 (69%), Positives = 91/107 (85%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGS+RCDVNIS+R G +FGTKVE+ ++N+FSA+ RAI+FEISRQ L+ +G+
Sbjct: 255 GNMQEGSLRCDVNISIRPIGQAEFGTKVEIKNLNAFSAISRAIDFEISRQALLYNQGKAD 314

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQSFVD 1
IV ETRLWEEG+Q+T+TMR KEGLADYRYFPEPDLPEV+L Q +VD
Sbjct: 315 QIVTETRLWEEGAQKTVTMRKKEGLADYRYFPEPDLPEVILTQEYVD 361


>tr|Q3ECU6|Q3ECU6_ARATH Uncharacterized protein At1g48520.2
OS=Arabidopsis thaliana GN=At1g48520 PE=4 SV=1
Length = 475

Score = 159 bits (401), Expect = 9e-38
Identities = 74/107 (69%), Positives = 91/107 (85%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGS+RCDVNIS+R G +FGTKVE+ ++N+FSA+ RAI+FEISRQ L+ +G+
Sbjct: 255 GNMQEGSLRCDVNISIRPIGQAEFGTKVEIKNLNAFSAISRAIDFEISRQALLYNQGKAD 314

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQSFVD 1
IV ETRLWEEG+Q+T+TMR KEGLADYRYFPEPDLPEV+L Q +VD
Sbjct: 315 QIVTETRLWEEGAQKTVTMRKKEGLADYRYFPEPDLPEVILTQEYVD 361


>tr|Q3E7E0|Q3E7E0_ARATH Uncharacterized protein At1g48520.3
OS=Arabidopsis thaliana GN=At1g48520 PE=4 SV=1
Length = 488

Score = 159 bits (401), Expect = 9e-38
Identities = 74/107 (69%), Positives = 91/107 (85%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGS+RCDVNIS+R G +FGTKVE+ ++N+FSA+ RAI+FEISRQ L+ +G+
Sbjct: 255 GNMQEGSLRCDVNISIRPIGQAEFGTKVEIKNLNAFSAISRAIDFEISRQALLYNQGKAD 314

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQSFVD 1
IV ETRLWEEG+Q+T+TMR KEGLADYRYFPEPDLPEV+L Q +VD
Sbjct: 315 QIVTETRLWEEGAQKTVTMRKKEGLADYRYFPEPDLPEVILTQEYVD 361


>tr|B7KGN0|B7KGN0_9CHRO Glutamyl-tRNA(Gln) amidotransferase, B
subunit OS=Cyanothece sp. PCC 7424 GN=PCC7424_3567 PE=4
SV=1
Length = 495

Score = 150 bits (379), Expect = 3e-35
Identities = 72/107 (67%), Positives = 87/107 (81%)
Frame = -1

Query: 321 GNMQEGSMRCDVNISVRKKGDEKFGTKVEMNHMNSFSAMQRAIEFEISRQVSLHGEGQPA 142
GNMQEGS+RCDVNISVR KG +KFGTKVE+ +MNSFSA+Q+AIE+EI RQ+ G+P
Sbjct: 203 GNMQEGSLRCDVNISVRPKGQKKFGTKVEIKNMNSFSAIQKAIEYEIERQIEAIENGEP- 261

Query: 141 FIVQETRLWEEGSQRTITMRLKEGLADYRYFPEPDLPEVVLEQSFVD 1
I ETRLWEEG QRT+TMRLKEG +DYRYFPEPDLP + + Q ++
Sbjct: 262 -IRLETRLWEEGKQRTVTMRLKEGASDYRYFPEPDLPPIEVSQEQIE 307