BP918936
Clone id YMU001_000119_C04
Library
Length 508
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000119_C04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AGCTCAGTATGCTCGCCATCTGACGCCAAATGGGTTGGCTGCCATTGCTGATGCAACTGA
GGGAATGTCAGGGCGTGACCTGCGAGATGTATGTCAGCAAGCTGAACGGCGATGGGCATC
AAAGGCAATTAGAAATAGCGCAAGCAGTCCTATGGCATGTGGTCTACCTCCACTGGAGGA
GTATATAGAGAGTGCACAGAAAAGGAGAACTACCATTCAAGTAATGCCATCTGAGCGAGG
TCATCGTGCAAGGCCCGGGGCAGCATGGCCACCATCTGTGGTAGTTTGAAGGGTCTGTCC
ACCTGTGTTCTTCTTGTCATGATATTATATACCTACTATATAGTGGCCATATCATATCAT
AACAGATTTGAGTCAGTATAATGAGTGAATCATGTGTTACTAGAGGACATGAAGTGAAGA
GAGCGCTGTAGATAGTGACATCAGTTAGAAGTGAGCATAGAGCGTGTCCATAATTACTGC
CCTATCCTGCATAAAGATAAACGGGGAC
■■Homology search results ■■ -
sp_hit_id P54815
Definition sp|P54815|MSP1_CAEEL Protein MSP1 homolog OS=Caenorhabditis elegans
Align length 49
Score (bit) 31.6
E-value 2.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918936|Adiantum capillus-veneris mRNA, clone:
YMU001_000119_C04.
(508 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P54815|MSP1_CAEEL Protein MSP1 homolog OS=Caenorhabditis eleg... 32 2.3
sp|Q7ZZ25|ATD1A_DANRE ATPase family AAA domain-containing protei... 32 2.3
sp|A6NMB9|FIGL2_HUMAN Putative fidgetin-like protein 2 OS=Homo s... 31 3.9
sp|Q9SI53|PP147_ARATH Pentatricopeptide repeat-containing protei... 30 5.0
sp|P28737|MSP1_YEAST Protein MSP1 OS=Saccharomyces cerevisiae GN... 30 5.0
sp|Q8PY58|PSMR_METMA Proteasome-activating nucleotidase OS=Metha... 30 6.6
sp|Q63433|PKN1_RAT Serine/threonine-protein kinase N1 OS=Rattus ... 30 6.6
sp|P23269|O1496_RAT Olfactory receptor 1496 OS=Rattus norvegicus... 30 6.6
sp|Q8BI69|ZN784_MOUSE Zinc finger protein 784 OS=Mus musculus GN... 30 8.6
sp|Q9VIQ9|SICK_DROME Protein sickie OS=Drosophila melanogaster G... 30 8.6
sp|P21415|ENV_GALV Envelope glycoprotein OS=Gibbon ape leukemia ... 30 8.6

>sp|P54815|MSP1_CAEEL Protein MSP1 homolog OS=Caenorhabditis elegans
GN=K04D7.2 PE=1 SV=2
Length = 342

Score = 31.6 bits (70), Expect = 2.3
Identities = 20/49 (40%), Positives = 27/49 (55%)
Frame = +2

Query: 35 LAAIADATEGMSGRDLRDVCQQAERRWASKAIRNSASSPMACGLPPLEE 181
L IA A EG+SG DL++VC+ A ++A AS L PLE+
Sbjct: 274 LGEIAQAAEGLSGSDLKEVCRLA---LLARAKATVASGGSVNQLLPLEQ 319


>sp|Q7ZZ25|ATD1A_DANRE ATPase family AAA domain-containing protein
1-A OS=Danio rerio GN=atad1a PE=2 SV=2
Length = 380

Score = 31.6 bits (70), Expect = 2.3
Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
Frame = +2

Query: 35 LAAIADATEGMSGRDLRDVCQQAERRWASKAIRNSASSPMA--CGLPPLEEYIESAQKRR 208
L IA +EG SG DL+++C+ A +R +A L EE+++S Q R
Sbjct: 287 LKEIASQSEGYSGSDLKELCRDAAMYRVRDYVRKQQMKQIAQQFQLDEEEEHVDSRQLRP 346

Query: 209 TT 214
T
Sbjct: 347 VT 348


>sp|A6NMB9|FIGL2_HUMAN Putative fidgetin-like protein 2 OS=Homo
sapiens GN=FIGNL2 PE=5 SV=2
Length = 653

Score = 30.8 bits (68), Expect = 3.9
Identities = 15/34 (44%), Positives = 20/34 (58%)
Frame = +2

Query: 2 AQYARHLTPNGLAAIADATEGMSGRDLRDVCQQA 103
AQ L+ LAA+ T+G SG +L +CQQA
Sbjct: 572 AQQGCALSERELAALVQGTQGFSGGELGQLCQQA 605


>sp|Q9SI53|PP147_ARATH Pentatricopeptide repeat-containing protein
At2g03880, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H44 PE=2 SV=1
Length = 630

Score = 30.4 bits (67), Expect = 5.0
Identities = 22/101 (21%), Positives = 42/101 (41%), Gaps = 8/101 (7%)
Frame = -1

Query: 454 SLLTDVTIYSALFT-SCPLVTHDSLIIL---TQICYDMIWPLYSRYIIS*QEEHRWTDPS 287
S+++ + ++ + T C + D ++L T++CY P + + S Q W D +
Sbjct: 3 SVMSKIKLFRPVVTLRCSYSSTDQTLLLSEFTRLCYQRDLPRAMKAMDSLQSHGLWADSA 62

Query: 286 NYHRWWPCCPGPCTMTS----LRWHYLNGSSPFLCTLYILL 176
Y CC + R Y NG P + + +L+
Sbjct: 63 TYSELIKCCISNRAVHEGNLICRHLYFNGHRPMMFLVNVLI 103


>sp|P28737|MSP1_YEAST Protein MSP1 OS=Saccharomyces cerevisiae
GN=MSP1 PE=1 SV=2
Length = 362

Score = 30.4 bits (67), Expect = 5.0
Identities = 14/33 (42%), Positives = 22/33 (66%)
Frame = +2

Query: 35 LAAIADATEGMSGRDLRDVCQQAERRWASKAIR 133
L IAD T+G SG DL+++C++A A + I+
Sbjct: 283 LQLIADNTKGFSGSDLKELCREAALDAAKEYIK 315


>sp|Q8PY58|PSMR_METMA Proteasome-activating nucleotidase
OS=Methanosarcina mazei GN=pan PE=3 SV=1
Length = 420

Score = 30.0 bits (66), Expect = 6.6
Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 3/66 (4%)
Frame = +2

Query: 44 IADATEGMSGRDLRDVCQQAERRWASKAIRNSASSPMACGLPPLEEYIESAQK---RRTT 214
+A ATEGMSG DL+ + +A A+R L +EE++E+ +K T
Sbjct: 357 LAKATEGMSGADLKAIATEA----GMFAVRRDKE------LVEMEEFLEAVEKVSMAADT 406

Query: 215 IQVMPS 232
++MPS
Sbjct: 407 QKMMPS 412


>sp|Q63433|PKN1_RAT Serine/threonine-protein kinase N1 OS=Rattus
norvegicus GN=Pkn1 PE=1 SV=1
Length = 946

Score = 30.0 bits (66), Expect = 6.6
Identities = 21/82 (25%), Positives = 32/82 (39%)
Frame = +2

Query: 14 RHLTPNGLAAIADATEGMSGRDLRDVCQQAERRWASKAIRNSASSPMACGLPPLEEYIES 193
R L PN +A + + G ++R + + A +S+S GLP + S
Sbjct: 523 RRLIPNAVATGSFSPNASPGSEIRSTGDISMEKLNLGADSDSSSQKSPAGLPSTSCSLSS 582

Query: 194 AQKRRTTIQVMPSERGHRARPG 259
TT +PSE PG
Sbjct: 583 PTHESTTSPELPSETQETPGPG 604


>sp|P23269|O1496_RAT Olfactory receptor 1496 OS=Rattus norvegicus
GN=Olr1496 PE=2 SV=1
Length = 310

Score = 30.0 bits (66), Expect = 6.6
Identities = 13/25 (52%), Positives = 15/25 (60%)
Frame = -1

Query: 226 HYLNGSSPFLCTLYILLQWR*TTCH 152
HY + SP LCT +LL W TT H
Sbjct: 129 HYTSIMSPKLCTCLVLLLWMLTTSH 153


>sp|Q8BI69|ZN784_MOUSE Zinc finger protein 784 OS=Mus musculus
GN=Znf784 PE=2 SV=1
Length = 297

Score = 29.6 bits (65), Expect = 8.6
Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 2/38 (5%)
Frame = -1

Query: 295 DPSNYHRWWPCCPGPCTMTSLRWHYL--NGSSPFLCTL 188
DPS H CPGP SLR HY G P+ C+L
Sbjct: 98 DPSRCHVCGHSCPGP---ASLRAHYSLHTGERPYRCSL 132


>sp|Q9VIQ9|SICK_DROME Protein sickie OS=Drosophila melanogaster
GN=sick PE=1 SV=3
Length = 2197

Score = 29.6 bits (65), Expect = 8.6
Identities = 26/83 (31%), Positives = 38/83 (45%), Gaps = 11/83 (13%)
Frame = -1

Query: 445 TDVTIYSALFTSCPLVTHDSLIILTQICYDMIWPLY-SRYIIS*QEE---------HRWT 296
+DVTI LF +CP+ DS Q+ + IW + S Y++ E W
Sbjct: 2058 SDVTIGPRLFLACPMDLKDS-----QVWFTDIWNYHLSPYLVEAVREGVQLYGRRGGAWN 2112

Query: 295 DPSNYHR-WWPCCPGPCTMTSLR 230
DPS + R +P GP ++ LR
Sbjct: 2113 DPSAFIRNSYPWPYGPDSVPPLR 2135


tr_hit_id A7R0N7
Definition tr|A7R0N7|A7R0N7_VITVI Chromosome chr10 scaffold_312, whole genome shotgun sequence OS=Vitis vinifera
Align length 73
Score (bit) 82.8
E-value 9.0e-15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918936|Adiantum capillus-veneris mRNA, clone:
YMU001_000119_C04.
(508 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7R0N7|A7R0N7_VITVI Chromosome chr10 scaffold_312, whole geno... 83 9e-15
tr|A8J6P5|A8J6P5_CHLRE Predicted protein OS=Chlamydomonas reinha... 79 1e-13
tr|Q6Z7T4|Q6Z7T4_ORYSJ Os02g0740300 protein OS=Oryza sativa subs... 77 4e-13
tr|B8AIG7|B8AIG7_ORYSI Putative uncharacterized protein OS=Oryza... 77 4e-13
tr|O81459|O81459_ARATH T27D20.13 protein (Putative vesicle trans... 74 5e-12
tr|A3AB72|A3AB72_ORYSJ Putative uncharacterized protein OS=Oryza... 61 4e-08
tr|B4FJK5|B4FJK5_MAIZE Putative uncharacterized protein OS=Zea m... 59 1e-07
tr|A0C7Q6|A0C7Q6_PARTE Chromosome undetermined scaffold_156, who... 57 7e-07
tr|A7R2U3|A7R2U3_VITVI Chromosome undetermined scaffold_453, who... 55 2e-06
tr|Q5CSL5|Q5CSL5_CRYPV CDC48 like AAA ATPase OS=Cryptosporidium ... 49 2e-04
tr|B6AHX9|B6AHX9_9CRYT ATPase, AAA family protein OS=Cryptospori... 48 2e-04
tr|Q5CEP9|Q5CEP9_CRYHO Vesicle transfer ATPase-related OS=Crypto... 48 3e-04
tr|Q052A8|Q052A8_LEPBL AAA family ATPase OS=Leptospira borgpeter... 45 0.003
tr|Q04RL3|Q04RL3_LEPBJ AAA family ATPase OS=Leptospira borgpeter... 45 0.003
tr|Q8F4H4|Q8F4H4_LEPIN ATPases of the AAA+ class OS=Leptospira i... 43 0.008
tr|Q72RA1|Q72RA1_LEPIC AAA family ATPase OS=Leptospira interroga... 43 0.008
tr|B0SR04|B0SR04_LEPBP Putative ATPase, AAA family OS=Leptospira... 39 0.11
tr|B0SHJ6|B0SHJ6_LEPBA AAA family ATPase OS=Leptospira biflexa s... 39 0.11
tr|B6LPY1|B6LPY1_BRAFL Putative uncharacterized protein OS=Branc... 37 0.55
tr|B7XHH8|B7XHH8_9MICR ATPase of the AAA+ class OS=Enterocytozoo... 37 0.72
tr|B7FUQ8|B7FUQ8_PHATR Predicted protein OS=Phaeodactylum tricor... 35 1.6
tr|Q67MC6|Q67MC6_SYMTH Pyruvate carboxylase OS=Symbiobacterium t... 35 2.7
tr|Q64911|Q64911_9ALPH Glycoprotein G (Fragment) OS=Equid herpes... 33 6.1
tr|A0E0B8|A0E0B8_PARTE Chromosome undetermined scaffold_71, whol... 33 6.1
tr|A0DVN2|A0DVN2_PARTE Chromosome undetermined scaffold_66, whol... 33 6.1
tr|Q291K5|Q291K5_DROPS GA21067 OS=Drosophila pseudoobscura pseud... 33 8.0
tr|B4GAL0|B4GAL0_DROPE GL10691 OS=Drosophila persimilis GN=GL106... 33 8.0

>tr|A7R0N7|A7R0N7_VITVI Chromosome chr10 scaffold_312, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00011515001
PE=3 SV=1
Length = 470

Score = 82.8 bits (203), Expect = 9e-15
Identities = 42/73 (57%), Positives = 51/73 (69%), Gaps = 1/73 (1%)
Frame = +2

Query: 2 AQYARHLTPNGLAAIADATEGMSGRDLRDVCQQAERRWASKAIRNSA-SSPMACGLPPLE 178
AQ+A+HLT + L A ATEGMSGRD+RD+CQQAER WASK IR A LPP++
Sbjct: 375 AQFAKHLTESELVEFATATEGMSGRDIRDICQQAERHWASKVIRGQAPKDGDQVILPPIQ 434

Query: 179 EYIESAQKRRTTI 217
YIESA+ R T+
Sbjct: 435 VYIESAKTRANTL 447


>tr|A8J6P5|A8J6P5_CHLRE Predicted protein OS=Chlamydomonas
reinhardtii GN=CHLREDRAFT_176020 PE=3 SV=1
Length = 534

Score = 79.3 bits (194), Expect = 1e-13
Identities = 43/88 (48%), Positives = 55/88 (62%), Gaps = 1/88 (1%)
Frame = +2

Query: 5 QYARHLTPNGLAAIADATEGMSGRDLRDVCQQAERRWASKAIRNSASSPMACGLPPLEEY 184
QYA+ L+ + L +A+ T GMSGRDLRDVC+ ERRWASK IR LPPL EY
Sbjct: 431 QYAQQLSDSELGQLAERTPGMSGRDLRDVCEHTERRWASKIIRGEVREE---ELPPLREY 487

Query: 185 IESAQKRRTTIQV-MPSERGHRARPGAA 265
+ SA +R + +Q + S RA+ GAA
Sbjct: 488 LASAAERASAVQASLSSSHPARAKEGAA 515


>tr|Q6Z7T4|Q6Z7T4_ORYSJ Os02g0740300 protein OS=Oryza sativa subsp.
japonica GN=P0516G10.11 PE=2 SV=1
Length = 611

Score = 77.4 bits (189), Expect = 4e-13
Identities = 40/77 (51%), Positives = 52/77 (67%), Gaps = 5/77 (6%)
Frame = +2

Query: 2 AQYARHLTPNGLAAIADATEGMSGRDLRDVCQQAERRWASKAIR-----NSASSPMACGL 166
AQYA+HLT + L + ATE MSGRD+RD+CQQAER WASK IR N P L
Sbjct: 522 AQYAKHLTKSELFQFSLATEEMSGRDIRDICQQAERHWASKLIRGQVPKNDKGEP---SL 578

Query: 167 PPLEEYIESAQKRRTTI 217
PP+EEY+ +++RR ++
Sbjct: 579 PPVEEYVACSEQRRRSL 595


>tr|B8AIG7|B8AIG7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_08877 PE=4 SV=1
Length = 612

Score = 77.4 bits (189), Expect = 4e-13
Identities = 40/77 (51%), Positives = 52/77 (67%), Gaps = 5/77 (6%)
Frame = +2

Query: 2 AQYARHLTPNGLAAIADATEGMSGRDLRDVCQQAERRWASKAIR-----NSASSPMACGL 166
AQYA+HLT + L + ATE MSGRD+RD+CQQAER WASK IR N P L
Sbjct: 523 AQYAKHLTKSELFQFSLATEEMSGRDIRDICQQAERHWASKLIRGQVPKNDKGEP---SL 579

Query: 167 PPLEEYIESAQKRRTTI 217
PP+EEY+ +++RR ++
Sbjct: 580 PPVEEYVACSEQRRRSL 596


>tr|O81459|O81459_ARATH T27D20.13 protein (Putative vesicle transfer
ATPase) OS=Arabidopsis thaliana GN=AT4g04180 PE=3 SV=1
Length = 536

Score = 73.6 bits (179), Expect = 5e-12
Identities = 38/90 (42%), Positives = 53/90 (58%), Gaps = 11/90 (12%)
Frame = +2

Query: 2 AQYARHLTPNGLAAIADATEGMSGRDLRDVCQQAERRWASKAIR-----------NSASS 148
AQYA+ L+ L +A ATE MSGRD+RDVCQ AER WASK I +
Sbjct: 431 AQYAKQLSKPELVQLAQATEAMSGRDIRDVCQGAERTWASKIINLYIVGQLIRRAKAGGE 490

Query: 149 PMACGLPPLEEYIESAQKRRTTIQVMPSER 238
LPP++EY+ESA+ RR +++ + ++
Sbjct: 491 EQKITLPPIQEYLESAEARRKSLRSVTEQK 520


>tr|A3AB72|A3AB72_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_008044 PE=3 SV=1
Length = 591

Score = 60.8 bits (146), Expect = 4e-08
Identities = 28/41 (68%), Positives = 33/41 (80%)
Frame = +2

Query: 2 AQYARHLTPNGLAAIADATEGMSGRDLRDVCQQAERRWASK 124
AQYA+HLT + L + ATE MSGRD+RD+CQQAER WASK
Sbjct: 519 AQYAKHLTKSELFQFSLATEEMSGRDIRDICQQAERHWASK 559


>tr|B4FJK5|B4FJK5_MAIZE Putative uncharacterized protein OS=Zea mays
PE=4 SV=1
Length = 69

Score = 58.9 bits (141), Expect = 1e-07
Identities = 28/53 (52%), Positives = 36/53 (67%), Gaps = 2/53 (3%)
Frame = +2

Query: 65 MSGRDLRDVCQQAERRWASKAIRNSA--SSPMACGLPPLEEYIESAQKRRTTI 217
MSGRD+RDVCQQAER WASK IR LPP++EY+ A++RR ++
Sbjct: 1 MSGRDIRDVCQQAERHWASKLIRGQVPKDEKGEPSLPPIDEYLSCAEQRRKSL 53


>tr|A0C7Q6|A0C7Q6_PARTE Chromosome undetermined scaffold_156, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00035954001 PE=4 SV=1
Length = 445

Score = 56.6 bits (135), Expect = 7e-07
Identities = 27/67 (40%), Positives = 41/67 (61%)
Frame = +2

Query: 5 QYARHLTPNGLAAIADATEGMSGRDLRDVCQQAERRWASKAIRNSASSPMACGLPPLEEY 184
+YA+HLT ++ + GMSGR++ D+C+ AERRWA+K IR + LP L +Y
Sbjct: 378 RYAKHLTDKERDILSQLSNGMSGRNISDICKDAERRWAAKLIRKEVTEQ----LPSLAQY 433

Query: 185 IESAQKR 205
E+ +R
Sbjct: 434 KETLTQR 440


>tr|A7R2U3|A7R2U3_VITVI Chromosome undetermined scaffold_453, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00013288001 PE=3 SV=1
Length = 795

Score = 55.1 bits (131), Expect = 2e-06
Identities = 24/36 (66%), Positives = 30/36 (83%)
Frame = +2

Query: 2 AQYARHLTPNGLAAIADATEGMSGRDLRDVCQQAER 109
AQ+A+HLT + L A ATEGMSG+D+RD+CQQAER
Sbjct: 485 AQFAKHLTESELVEFATATEGMSGKDIRDICQQAER 520


>tr|Q5CSL5|Q5CSL5_CRYPV CDC48 like AAA ATPase OS=Cryptosporidium
parvum Iowa II GN=cgd1_2180 PE=3 SV=1
Length = 593

Score = 48.5 bits (114), Expect = 2e-04
Identities = 26/70 (37%), Positives = 38/70 (54%), Gaps = 3/70 (4%)
Frame = +2

Query: 5 QYARHLTPNGLAAIADATEGMSGRDLRDVCQQAERRWASKAIRNSASSPM---ACGLPPL 175
QYA+HLT +A ++ +SGR +R VC +AER WAS ++ LP +
Sbjct: 522 QYAKHLTFEERMVLAKMSKKLSGRSIRHVCLEAEREWASMILKKKEKGEYQRDEIELPTI 581

Query: 176 EEYIESAQKR 205
E Y E+ +KR
Sbjct: 582 EIYKEALKKR 591