BP918957
Clone id YMU001_000119_E03
Library
Length 458
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000119_E03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATGATGGTGGGAGAGTTGCGTAGGTTATTGCCTTATGCTTAATGGGCTGATAGTACAACT
CATAGCTCAGTTACCGGTTATATGCCTTTTGAGTTGATGTACGGTCAGAAACCTATAATG
TCAATTGAGGATGTAATTCCCACATGGAATGTATTGCCTTGGGAGGATGGACTGAGTACG
GAAGACCACCTTGATTTGCACATTCAGCAGTTAGAAAGAAGGCCTCAAGATATTGAGATT
GCAATAGCACGATTAAAAGAGACAAGGTTAAAGAATAAGGACTTATTTGATAAGAGGCAT
AGGCTCAAACCTATAGCTATTGAGGAAGGTGATTGGGTGTGTAGGTGTATGACAGTAGTC
TTGACAACCAGCATTCACCAATAAGAAAGCTTTCATCGAGATGGTCTGGTCCTTATGTGG
TTCAGCATGTACATGGGAATGCAACTTATACCTTCATG
■■Homology search results ■■ -
sp_hit_id Q7U5J9
Definition sp|Q7U5J9|COBQ_SYNPX Cobyric acid synthase OS=Synechococcus sp. (strain WH8102)
Align length 41
Score (bit) 33.5
E-value 0.45
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918957|Adiantum capillus-veneris mRNA, clone:
YMU001_000119_E03.
(458 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q7U5J9|COBQ_SYNPX Cobyric acid synthase OS=Synechococcus sp. ... 33 0.45
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from tra... 33 0.59
sp|Q5N2H9|COBQ_SYNP6 Cobyric acid synthase OS=Synechococcus sp. ... 32 1.3
sp|Q31RS6|COBQ_SYNE7 Cobyric acid synthase OS=Synechococcus elon... 32 1.3
sp|A5GMB9|COBQ_SYNPW Cobyric acid synthase OS=Synechococcus sp. ... 31 2.3
sp|Q466W7|COBQ_METBF Probable cobyric acid synthase OS=Methanosa... 31 2.9
sp|Q8NCM8|DYHC2_HUMAN Cytoplasmic dynein 2 heavy chain 1 OS=Homo... 30 3.8
sp|Q3ALJ7|COBQ_SYNSC Cobyric acid synthase OS=Synechococcus sp. ... 30 3.8
sp|Q7V6H6|COBQ_PROMM Cobyric acid synthase OS=Prochlorococcus ma... 30 3.8
sp|A2C7X7|COBQ_PROM3 Cobyric acid synthase OS=Prochlorococcus ma... 30 3.8
sp|Q45VK7|DYHC2_MOUSE Cytoplasmic dynein 2 heavy chain 1 OS=Mus ... 30 5.0
sp|P38739|WSC4_YEAST Cell wall integrity and stress response com... 30 6.6
sp|Q6BKI8|NNT1_DEBHA Putative nicotinamide N-methyltransferase O... 30 6.6
sp|Q9JJ79|DYHC2_RAT Cytoplasmic dynein 2 heavy chain 1 OS=Rattus... 30 6.6
sp|A5GUP3|COBQ_SYNR3 Cobyric acid synthase OS=Synechococcus sp. ... 30 6.6
sp|P40005|PFD2_YEAST Prefoldin subunit 2 OS=Saccharomyces cerevi... 29 8.6
sp|Q96R30|OR2V2_HUMAN Olfactory receptor 2V2 OS=Homo sapiens GN=... 29 8.6
sp|A2C3V9|COBQ_PROM1 Cobyric acid synthase OS=Prochlorococcus ma... 29 8.6
sp|A6TU70|COBQ_ALKMQ Cobyric acid synthase OS=Alkaliphilus metal... 29 8.6

>sp|Q7U5J9|COBQ_SYNPX Cobyric acid synthase OS=Synechococcus sp.
(strain WH8102) GN=cobQ PE=3 SV=1
Length = 496

Score = 33.5 bits (75), Expect = 0.45
Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
Frame = +1

Query: 136 IPTWNVLPW-EDGLSTEDHLDLHIQQLERRPQDIEIAIARL 255
+P V+PW D ED LDL ++ R P D+EIA+ +L
Sbjct: 223 VPVLGVMPWLNDLFPPEDSLDLLERKPNRGPTDLEIAVLKL 263


>sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from
transposon 412 OS=Drosophila melanogaster GN=POL PE=4
SV=1
Length = 1237

Score = 33.1 bits (74), Expect = 0.59
Identities = 31/113 (27%), Positives = 54/113 (47%), Gaps = 9/113 (7%)
Frame = +1

Query: 28 LPYA*WADSTTHSSVTGYMPFELMYGQ-----KPIMSIEDVIPTWNVLPWEDGLSTEDHL 192
L Y + +TT S V Y P+EL++G+ K + + P +N+
Sbjct: 1092 LQYFVYCFNTTQSMVHNYCPYELVFGRTSNLPKHFNKLHSIEPIYNI------------- 1138

Query: 193 DLHIQQLERRPQDIEIAIAR----LKETRLKNKDLFDKRHRLKPIAIEEGDWV 339
D + ++ + R +E+A AR L+ + KNK+ +D ++K I +E GD V
Sbjct: 1139 DDYAKESKYR---LEVAYARARKLLEAHKEKNKENYDL--KVKDIELEVGDKV 1186


>sp|Q5N2H9|COBQ_SYNP6 Cobyric acid synthase OS=Synechococcus sp.
(strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cobQ
PE=3 SV=1
Length = 491

Score = 32.0 bits (71), Expect = 1.3
Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
Frame = +1

Query: 136 IPTWNVLPWED-GLSTEDHLDLHIQQLERRPQDIEIAIARLKETRLKNKDLFD 291
IP V+PW D +ED LDL + RR E+ IA ++ R+ N FD
Sbjct: 218 IPVLGVIPWIDRAFPSEDSLDL--MERRRRKTQAEVTIAVIRLPRIANFTDFD 268


>sp|Q31RS6|COBQ_SYNE7 Cobyric acid synthase OS=Synechococcus
elongatus (strain PCC 7942) GN=cobQ PE=3 SV=1
Length = 491

Score = 32.0 bits (71), Expect = 1.3
Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
Frame = +1

Query: 136 IPTWNVLPWED-GLSTEDHLDLHIQQLERRPQDIEIAIARLKETRLKNKDLFD 291
IP V+PW D +ED LDL + RR E+ IA ++ R+ N FD
Sbjct: 218 IPVLGVIPWIDRAFPSEDSLDL--MERRRRKTQAEVTIAVIRLPRIANFTDFD 268


>sp|A5GMB9|COBQ_SYNPW Cobyric acid synthase OS=Synechococcus sp.
(strain WH7803) GN=cobQ PE=3 SV=1
Length = 494

Score = 31.2 bits (69), Expect = 2.3
Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
Frame = +1

Query: 136 IPTWNVLPWEDGL-STEDHLDLHIQQLERRPQDIEIAIARL 255
IP V+PW D L ED LDL ++ +R ++EIA+ +L
Sbjct: 216 IPVLGVMPWLDELFPPEDSLDLLERRGRKRGAELEIAVLKL 256


>sp|Q466W7|COBQ_METBF Probable cobyric acid synthase
OS=Methanosarcina barkeri (strain Fusaro / DSM 804)
GN=cobQ PE=3 SV=1
Length = 485

Score = 30.8 bits (68), Expect = 2.9
Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
Frame = +1

Query: 136 IPTWNVLPW-EDGLSTEDHLDLHIQQLERRPQDIEIAIARLKETRLKNKDLFDKRHRLKP 312
IP VLP+ + + +ED + L ++ E+ ++IEIA+ RL R+ N F+ R
Sbjct: 218 IPVLGVLPYFKLNIPSEDSVSLEDKEAEKNEKEIEIAVIRL--PRISNFTDFEPLERSAK 275

Query: 313 IAIEEGD 333
I E D
Sbjct: 276 IRYVELD 282


>sp|Q8NCM8|DYHC2_HUMAN Cytoplasmic dynein 2 heavy chain 1 OS=Homo
sapiens GN=DYNC2H1 PE=1 SV=3
Length = 4307

Score = 30.4 bits (67), Expect = 3.8
Identities = 12/28 (42%), Positives = 20/28 (71%)
Frame = -3

Query: 396 MKAFLLVNAGCQDYCHTPTHPITFLNSY 313
+K+FLL++ C+ Y TP+ +TFL+ Y
Sbjct: 2852 LKSFLLIHESCKAYGATPSQYMTFLHVY 2879


>sp|Q3ALJ7|COBQ_SYNSC Cobyric acid synthase OS=Synechococcus sp.
(strain CC9605) GN=cobQ PE=3 SV=1
Length = 498

Score = 30.4 bits (67), Expect = 3.8
Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
Frame = +1

Query: 136 IPTWNVLPWEDGL-STEDHLDLHIQQLERRPQDIEIAIARL 255
+P V+PW + L ED LDL ++ R D+EIA+ RL
Sbjct: 225 VPVLGVMPWLNELFPPEDSLDLLERKPTRGATDLEIAVLRL 265


>sp|Q7V6H6|COBQ_PROMM Cobyric acid synthase OS=Prochlorococcus
marinus (strain MIT 9313) GN=cobQ PE=3 SV=1
Length = 501

Score = 30.4 bits (67), Expect = 3.8
Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
Frame = +1

Query: 118 MSIEDVIPTWNVLPW-EDGLSTEDHLDLHIQQLERRPQDIEIAIARL 255
+ E IP V+PW E+ ED LDL ++ ++ +IEIA+ +L
Sbjct: 215 LEAETGIPVIGVMPWLEELFPPEDSLDLLERRGKKNDAEIEIAVLKL 261


>sp|A2C7X7|COBQ_PROM3 Cobyric acid synthase OS=Prochlorococcus
marinus (strain MIT 9303) GN=cobQ PE=3 SV=1
Length = 506

Score = 30.4 bits (67), Expect = 3.8
Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
Frame = +1

Query: 118 MSIEDVIPTWNVLPW-EDGLSTEDHLDLHIQQLERRPQDIEIAIARL 255
+ E IP V+PW E+ ED LDL ++ ++ +IEIA+ +L
Sbjct: 220 LEAETGIPVIGVMPWLEELFPPEDSLDLLERRGKKNDAEIEIAVLKL 266


tr_hit_id Q45W58
Definition tr|Q45W58|Q45W58_PHACH Polyprotein (Fragment) OS=Phanerochaete chrysosporium RP-78
Align length 96
Score (bit) 67.0
E-value 2.0e-14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918957|Adiantum capillus-veneris mRNA, clone:
YMU001_000119_E03.
(458 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q45W58|Q45W58_PHACH Polyprotein (Fragment) OS=Phanerochaete c... 67 2e-14
tr|A6SHV6|A6SHV6_BOTFB Putative uncharacterized protein OS=Botry... 70 2e-12
tr|A6RNZ8|A6RNZ8_BOTFB Putative uncharacterized protein OS=Botry... 70 2e-12
tr|A9RDD7|A9RDD7_PHYPA Predicted protein OS=Physcomitrella paten... 55 2e-11
tr|B8P7Y2|B8P7Y2_9APHY Predicted protein (Fragment) OS=Postia pl... 68 2e-10
tr|Q9C0U1|Q9C0U1_YARLI YALI0A10395p OS=Yarrowia lipolytica GN=ta... 52 2e-07
tr|Q6CHG3|Q6CHG3_YARLI YALI0A08932p OS=Yarrowia lipolytica GN=YA... 52 2e-07
tr|Q6CFJ9|Q6CFJ9_YARLI YALI0B06303p OS=Yarrowia lipolytica GN=YA... 52 2e-07
tr|Q6CFJ4|Q6CFJ4_YARLI YALI0B06446p OS=Yarrowia lipolytica GN=YA... 52 2e-07
tr|Q6C613|Q6C613_YARLI YALI0E13376p OS=Yarrowia lipolytica GN=YA... 52 2e-07
tr|Q6C3G7|Q6C3G7_YARLI YALI0E34980p OS=Yarrowia lipolytica GN=YA... 52 2e-07
tr|B3GGB9|B3GGB9_PODAN Gag-pol polyprotein OS=Podospora anserina... 49 3e-07
tr|A5AH94|A5AH94_VITVI Putative uncharacterized protein OS=Vitis... 41 5e-06
tr|Q1DKB8|Q1DKB8_COCIM Putative uncharacterized protein OS=Cocci... 53 9e-06
tr|A8PI98|A8PI98_COPC7 Putative uncharacterized protein OS=Copri... 53 9e-06
tr|A5BP21|A5BP21_VITVI Putative uncharacterized protein OS=Vitis... 36 4e-05
tr|Q3I6J4|Q3I6J4_SILLA Pol-polyprotein OS=Silene latifolia GN=po... 49 1e-04
tr|B8NZN4|B8NZN4_9APHY Predicted protein OS=Postia placenta Mad-... 37 1e-04
tr|A5E5J5|A5E5J5_LODEL Putative uncharacterized protein OS=Lodde... 41 2e-04
tr|A5H2S6|A5H2S6_LODEL Putative uncharacterized protein OS=Lodde... 41 2e-04
tr|Q9MFD2|Q9MFD2_BETVU Orf764 protein OS=Beta vulgaris subsp. vu... 47 2e-04
tr|Q5U6F6|Q5U6F6_BETVU Orf764 protein OS=Beta vulgaris subsp. vu... 47 2e-04
tr|A5E5N2|A5E5N2_LODEL Putative uncharacterized protein OS=Lodde... 42 4e-04
tr|A5BY72|A5BY72_VITVI Putative uncharacterized protein OS=Vitis... 34 7e-04
tr|Q2HW89|Q2HW89_MEDTR Integrase, catalytic region; Ribonuclease... 46 8e-04
tr|A5C5I0|A5C5I0_VITVI Putative uncharacterized protein OS=Vitis... 41 0.002
tr|A5BKG7|A5BKG7_VITVI Putative uncharacterized protein OS=Vitis... 41 0.002
tr|A5AJJ1|A5AJJ1_VITVI Putative uncharacterized protein OS=Vitis... 42 0.002
tr|A5BFP2|A5BFP2_VITVI Putative uncharacterized protein OS=Vitis... 41 0.002
tr|A8PH41|A8PH41_COPC7 Putative uncharacterized protein OS=Copri... 41 0.002

>tr|Q45W58|Q45W58_PHACH Polyprotein (Fragment) OS=Phanerochaete
chrysosporium RP-78 GN=pol PE=4 SV=1
Length = 638

Score = 67.0 bits (162), Expect(2) = 2e-14
Identities = 37/96 (38%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
Frame = +1

Query: 58 THSSVTGYMPFELMYGQKPIMSIEDVIPTWNVLPWEDGLSTEDHLDLHIQQLERRPQDIE 237
T S TG+ P+ L YGQ + + TW VL W+ +TED L ++QL RR +DI
Sbjct: 397 TTSRATGFTPYFLTYGQHALFPFDISDRTWFVLDWDKVETTEDLLVTRVKQLARREEDIG 456

Query: 238 IAIARLKETRLKNKDLFDKRH--RLKPIAIEEGDWV 339
A+ L+E+R + + ++RH RL+ A+E G WV
Sbjct: 457 SAVEHLEESRRRAAEDHNRRHAARLRNEALEPGTWV 492



Score = 35.0 bits (79), Expect(2) = 2e-14
Identities = 16/35 (45%), Positives = 23/35 (65%)
Frame = +3

Query: 345 VYDSSLDNQHSPIRKLSSRWSGPYVVQHVHGNATY 449
V+++ LDNQH K + RW+GPYVV H + +Y
Sbjct: 494 VHETWLDNQHG--NKGALRWAGPYVVHERHESGSY 526


>tr|A6SHV6|A6SHV6_BOTFB Putative uncharacterized protein
OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_12337
PE=4 SV=1
Length = 1114

Score = 70.5 bits (171), Expect(2) = 2e-12
Identities = 40/99 (40%), Positives = 52/99 (52%)
Frame = +1

Query: 43 WADSTTHSSVTGYMPFELMYGQKPIMSIEDVIPTWNVLPWEDGLSTEDHLDLHIQQLERR 222
+AD T T PF ++YG+ P++ IE TW VL WE S ED L L ++QLE
Sbjct: 866 FADRVTTHRPTNLTPFYVIYGRHPVLPIETQYSTWRVLDWEKVTSREDLLALRLRQLEMH 925

Query: 223 PQDIEIAIARLKETRLKNKDLFDKRHRLKPIAIEEGDWV 339
D+E A+ R K RL K FDK + + I GD V
Sbjct: 926 DLDMEEAVMRKKRYRLDGKARFDKDNNVIDKKITAGDIV 964



Score = 24.6 bits (52), Expect(2) = 2e-12
Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 1/23 (4%)
Frame = +3

Query: 384 RKLSSRWSGPYVVQHVHGN-ATY 449
RKL RW GPY V V N +TY
Sbjct: 979 RKLGYRWLGPYRVNKVLPNKSTY 1001


>tr|A6RNZ8|A6RNZ8_BOTFB Putative uncharacterized protein
OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_02171
PE=4 SV=1
Length = 1114

Score = 70.5 bits (171), Expect(2) = 2e-12
Identities = 40/99 (40%), Positives = 52/99 (52%)
Frame = +1

Query: 43 WADSTTHSSVTGYMPFELMYGQKPIMSIEDVIPTWNVLPWEDGLSTEDHLDLHIQQLERR 222
+AD T T PF ++YG+ P++ IE TW VL WE S ED L L ++QLE
Sbjct: 866 FADRVTTHRPTNLTPFYVIYGRHPVLPIETQYSTWRVLDWEKVTSREDLLALRLRQLEMH 925

Query: 223 PQDIEIAIARLKETRLKNKDLFDKRHRLKPIAIEEGDWV 339
D+E A+ R K RL K FDK + + I GD V
Sbjct: 926 DLDMEEAVMRKKRYRLDGKARFDKDNNVIDKKITAGDIV 964



Score = 24.6 bits (52), Expect(2) = 2e-12
Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 1/23 (4%)
Frame = +3

Query: 384 RKLSSRWSGPYVVQHVHGN-ATY 449
RKL RW GPY V V N +TY
Sbjct: 979 RKLGYRWLGPYRVNKVLPNKSTY 1001


>tr|A9RDD7|A9RDD7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_64592 PE=4 SV=1
Length = 203

Score = 54.7 bits (130), Expect(2) = 2e-11
Identities = 22/36 (61%), Positives = 27/36 (75%)
Frame = +3

Query: 345 VYDSSLDNQHSPIRKLSSRWSGPYVVQHVHGNATYT 452
+YDSSLDNQH +RK S RW GPY+V +H N TY+
Sbjct: 103 LYDSSLDNQHCTLRKFSKRWFGPYMVTTIHDNTTYS 138



Score = 37.0 bits (84), Expect(2) = 2e-11
Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 7/63 (11%)
Frame = +1

Query: 169 GLSTEDHLDLHIQQ----LERRPQDIEIAIARLKETRLKNKDLF---DKRHRLKPIAIEE 327
G T D+ +L++Q+ ER ++ + A E K++ L +K+HRL+P IEE
Sbjct: 38 GKITADYGELNVQEAREFFERCGIELSLTTAYNLEENAKSQKLIMPIEKKHRLRPKTIEE 97

Query: 328 GDW 336
GDW
Sbjct: 98 GDW 100


>tr|B8P7Y2|B8P7Y2_9APHY Predicted protein (Fragment) OS=Postia
placenta Mad-698-R GN=POSPLDRAFT_25643 PE=4 SV=1
Length = 239

Score = 68.2 bits (165), Expect = 2e-10
Identities = 37/104 (35%), Positives = 63/104 (60%), Gaps = 2/104 (1%)
Frame = +1

Query: 34 YA*WADSTTHSSVTGYMPFELMYGQKPIMSIEDVIPTWNVLPWEDGLSTEDHLDLHIQQL 213
+A + D T S TGY P+ L+YG P++ + + ++ + + G+ST D L L I+QL
Sbjct: 95 HAFFTDRITVSHATGYSPYYLLYGVHPVLPFDLLETSFMIENFRAGMSTSDLLALRIRQL 154

Query: 214 ERRPQDIEIAIARLKETRLKNKDLFDKRH--RLKPIAIEEGDWV 339
+++P+DI A LK +RL++K +F++R+ RL+ GD V
Sbjct: 155 QKKPEDITRAAEVLKRSRLQSKQVFERRYAKRLQKEVYNPGDLV 198


>tr|Q9C0U1|Q9C0U1_YARLI YALI0A10395p OS=Yarrowia lipolytica GN=ta PE=4
SV=2
Length = 2621

Score = 52.0 bits (123), Expect(2) = 2e-07
Identities = 33/101 (32%), Positives = 47/101 (46%), Gaps = 6/101 (5%)
Frame = +1

Query: 43 WADSTTHSSVTGYMPFELMYGQKPIMSIEDVIPTWNVLPWEDGLSTEDHLD-LHIQQLER 219
WAD T S TG PFELMYG ++ +E TWN L + L+ D ++ L+
Sbjct: 2384 WADRCTRRSSTGKSPFELMYGVSGVLPVESRFLTWNYLSGKTDLAHNDPAHAAFLRTLQL 2443

Query: 220 RPQDIEIAIAR--LKETRLKNKDLFDKRHR---LKPIAIEE 327
E+ AR L R + K +DK H P+A+ +
Sbjct: 2444 AASTFEVGSARDHLTLQRQRQKAFYDKHHNTADTDPLAVND 2484



Score = 26.2 bits (56), Expect(2) = 2e-07
Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
Frame = +3

Query: 378 PIRKLSSRWSGPYVVQHVH-GNATYT 452
P KL+ RW+GP +V H +TYT
Sbjct: 2493 PHNKLTPRWTGPSIVTACHPETSTYT 2518


>tr|Q6CHG3|Q6CHG3_YARLI YALI0A08932p OS=Yarrowia lipolytica
GN=YALI0A08932g PE=4 SV=1
Length = 2621

Score = 52.0 bits (123), Expect(2) = 2e-07
Identities = 33/101 (32%), Positives = 47/101 (46%), Gaps = 6/101 (5%)
Frame = +1

Query: 43 WADSTTHSSVTGYMPFELMYGQKPIMSIEDVIPTWNVLPWEDGLSTEDHLD-LHIQQLER 219
WAD T S TG PFELMYG ++ +E TWN L + L+ D ++ L+
Sbjct: 2384 WADRCTRRSSTGKSPFELMYGVSGVLPVESRFLTWNYLSGKTDLAHNDPAHAAFLRTLQL 2443

Query: 220 RPQDIEIAIAR--LKETRLKNKDLFDKRHR---LKPIAIEE 327
E+ AR L R + K +DK H P+A+ +
Sbjct: 2444 AASTFEVGSARDHLTLQRQRQKAFYDKHHNTADTDPLAVND 2484



Score = 26.2 bits (56), Expect(2) = 2e-07
Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
Frame = +3

Query: 378 PIRKLSSRWSGPYVVQHVH-GNATYT 452
P KL+ RW+GP +V H +TYT
Sbjct: 2493 PHNKLTPRWTGPSIVTACHPETSTYT 2518


>tr|Q6CFJ9|Q6CFJ9_YARLI YALI0B06303p OS=Yarrowia lipolytica
GN=YALI0B06303g PE=4 SV=1
Length = 2621

Score = 52.0 bits (123), Expect(2) = 2e-07
Identities = 33/101 (32%), Positives = 47/101 (46%), Gaps = 6/101 (5%)
Frame = +1

Query: 43 WADSTTHSSVTGYMPFELMYGQKPIMSIEDVIPTWNVLPWEDGLSTEDHLD-LHIQQLER 219
WAD T S TG PFELMYG ++ +E TWN L + L+ D ++ L+
Sbjct: 2384 WADRCTRRSSTGKSPFELMYGVSGVLPVESRFLTWNYLSGKTDLAHNDPAHAAFLRTLQL 2443

Query: 220 RPQDIEIAIAR--LKETRLKNKDLFDKRHR---LKPIAIEE 327
E+ AR L R + K +DK H P+A+ +
Sbjct: 2444 AASTFEVGSARDHLTLQRQRQKAFYDKHHNTADTDPLAVND 2484



Score = 26.2 bits (56), Expect(2) = 2e-07
Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
Frame = +3

Query: 378 PIRKLSSRWSGPYVVQHVH-GNATYT 452
P KL+ RW+GP +V H +TYT
Sbjct: 2493 PHNKLTPRWTGPSIVTACHPETSTYT 2518


>tr|Q6CFJ4|Q6CFJ4_YARLI YALI0B06446p OS=Yarrowia lipolytica
GN=YALI0B06446g PE=4 SV=1
Length = 2621

Score = 52.0 bits (123), Expect(2) = 2e-07
Identities = 33/101 (32%), Positives = 47/101 (46%), Gaps = 6/101 (5%)
Frame = +1

Query: 43 WADSTTHSSVTGYMPFELMYGQKPIMSIEDVIPTWNVLPWEDGLSTEDHLD-LHIQQLER 219
WAD T S TG PFELMYG ++ +E TWN L + L+ D ++ L+
Sbjct: 2384 WADRCTRRSSTGKSPFELMYGVSGVLPVESRFLTWNYLSGKTDLAHNDPAHAAFLRTLQL 2443

Query: 220 RPQDIEIAIAR--LKETRLKNKDLFDKRHR---LKPIAIEE 327
E+ AR L R + K +DK H P+A+ +
Sbjct: 2444 AASTFEVGSARDHLTLQRQRQKAFYDKHHNTADTDPLAVND 2484



Score = 26.2 bits (56), Expect(2) = 2e-07
Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
Frame = +3

Query: 378 PIRKLSSRWSGPYVVQHVH-GNATYT 452
P KL+ RW+GP +V H +TYT
Sbjct: 2493 PHNKLTPRWTGPSIVTACHPETSTYT 2518


>tr|Q6C613|Q6C613_YARLI YALI0E13376p OS=Yarrowia lipolytica
GN=YALI0E13376g PE=4 SV=1
Length = 2621

Score = 52.0 bits (123), Expect(2) = 2e-07
Identities = 33/101 (32%), Positives = 47/101 (46%), Gaps = 6/101 (5%)
Frame = +1

Query: 43 WADSTTHSSVTGYMPFELMYGQKPIMSIEDVIPTWNVLPWEDGLSTEDHLD-LHIQQLER 219
WAD T S TG PFELMYG ++ +E TWN L + L+ D ++ L+
Sbjct: 2384 WADRCTRRSSTGKSPFELMYGVSGVLPVESRFLTWNYLSGKTDLAHNDPAHAAFLRTLQL 2443

Query: 220 RPQDIEIAIAR--LKETRLKNKDLFDKRHR---LKPIAIEE 327
E+ AR L R + K +DK H P+A+ +
Sbjct: 2444 AASTFEVGSARDHLTLQRQRQKAFYDKHHNTADTDPLAVND 2484



Score = 26.2 bits (56), Expect(2) = 2e-07
Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
Frame = +3

Query: 378 PIRKLSSRWSGPYVVQHVH-GNATYT 452
P KL+ RW+GP +V H +TYT
Sbjct: 2493 PHNKLTPRWTGPSIVTACHPETSTYT 2518