BP918962
Clone id YMU001_000119_E08
Library
Length 318
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000119_E08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTTCAAAACACGGAAAAGGATGGCATATGCCAAAATAGAGTTCCATAATGCCAGCATGA
TGATATAGAATTTACAAAGATCGTGTTTACATTATCTGTAATCCCTCCTATCCCCCCATT
TACATCCATCTACTCCCTAGCCATGTCATCTTATCTTATGTGTGTAAATGCAGAACCTGA
TTCAAAAGATTGAAGTACCTGCAAATGCTCAAAATGGGATTCGTAAGTAAACCAACCATG
CCCACTCAATGAATCACAGAGACTTCAGTTAATTGGCATGGGGCTTCGAAAGGTCTTTTT
CATCACCATCGGTAATCT
■■Homology search results ■■ -
sp_hit_id Q8CUM9
Definition sp|Q8CUM9|ARGD_OCEIH Acetylornithine aminotransferase OS=Oceanobacillus iheyensis
Align length 49
Score (bit) 29.3
E-value 6.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918962|Adiantum capillus-veneris mRNA, clone:
YMU001_000119_E08.
(318 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8CUM9|ARGD_OCEIH Acetylornithine aminotransferase OS=Oceanob... 29 6.3
sp|P51784|UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 O... 29 8.2
sp|P28799|GRN_HUMAN Granulins OS=Homo sapiens GN=GRN PE=1 SV=2 29 8.3

>sp|Q8CUM9|ARGD_OCEIH Acetylornithine aminotransferase
OS=Oceanobacillus iheyensis GN=argD PE=3 SV=1
Length = 399

Score = 29.3 bits (64), Expect = 6.3
Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 5/49 (10%)
Frame = -1

Query: 150 DDMARE*MDVNGGI-----GGITDNVNTIFVNSISSCWHYGTLFWHMPS 19
DD + +D GI G + DNV N + WH L+ H+PS
Sbjct: 32 DDNGEKYLDYTSGIATCNLGHVPDNVQHAISNQLKDLWHCSNLY-HIPS 79


>sp|P51784|UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11
OS=Homo sapiens GN=USP11 PE=1 SV=2
Length = 920

Score = 28.9 bits (63), Expect = 8.2
Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%)
Frame = -1

Query: 174 SAFTHIR*DDMARE*MDVNG--GIGGITDNVNTIFVNSISSC 55
SA H+ ++M+ E D G GI G+T+ NT F+NS C
Sbjct: 242 SAQLHVMNNNMSEEDEDFKGQPGICGLTNLGNTCFMNSALQC 283


>sp|P28799|GRN_HUMAN Granulins OS=Homo sapiens GN=GRN PE=1 SV=2
Length = 593

Score = 28.9 bits (63), Expect = 8.3
Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 8/66 (12%)
Frame = +2

Query: 29 CQNRVP*CQHDDIEFTKIVFTLSVIPP--------IPPFTSIYSLAMSSYLMCVNAEPDS 184
C++RV C H F +V T + P +P + ++A+SS +MC +A
Sbjct: 158 CEDRVHCCPHG--AFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRC 215

Query: 185 KD*STC 202
D STC
Sbjct: 216 PDGSTC 221


tr_hit_id Q9AQR0
Definition tr|Q9AQR0|Q9AQR0_9BACI Protease (Fragment) OS=Bacillus sp. NV1
Align length 36
Score (bit) 33.5
E-value 5.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918962|Adiantum capillus-veneris mRNA, clone:
YMU001_000119_E08.
(318 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9AQR0|Q9AQR0_9BACI Protease (Fragment) OS=Bacillus sp. NV1 G... 33 5.4

>tr|Q9AQR0|Q9AQR0_9BACI Protease (Fragment) OS=Bacillus sp. NV1
GN=PROE PE=4 SV=1
Length = 434

Score = 33.5 bits (75), Expect = 5.4
Identities = 15/36 (41%), Positives = 21/36 (58%)
Frame = -1

Query: 129 MDVNGGIGGITDNVNTIFVNSISSCWHYGTLFWHMP 22
MD NGG+GG+ NV+T+F + S+ T W P
Sbjct: 98 MDSNGGLGGLPSNVSTLFSQAYSAGARIHTNSWGAP 133