BP918992
Clone id YMU001_000119_H04
Library
Length 453
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000119_H04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CACAGGGAACGTGGCCCTGGAACGCTGTGCTTGAATAGGAAACCTGTTCCCCTTGCTCCC
TCTCTCTGGGAAGTCCCTATTTTCTTGGTCCAGACAGCTTTGTATCTTAACCTGTAGGTG
GACAAGGCTGCCTCGCCTTATGGTAAGTAAACTGTGTGTGTGTTGGTAAGGACATCCGCT
ACCACAACTCTTTCTGCCCGGTTTCCTACTCAGTTCCCACCTTTGCTAGCAGACACTAGA
CAAACGGGTTTCCTCTAGGTCTTTTGGCTTTCCTTTCTTCGCCTTTAGGTTCGGTTGATG
ACCCTCTTTTAGAACTTTGCAGCTGATTCCCTTTTGGCATGTTGCCTTTGCCTCACCTGT
TTTGTCCTCCCTTCTCCTCTGGCAGTCCTTTAGCAGCTTCTGGGAGCATGGGCTGAGCTG
TAATGGGAGTTCCTTCTATGTGTCTAGATTGGT
■■Homology search results ■■ -
sp_hit_id Q5JNZ3
Definition sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens
Align length 33
Score (bit) 32.3
E-value 0.99
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918992|Adiantum capillus-veneris mRNA, clone:
YMU001_000119_H04.
(453 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN... 32 0.99
sp|P05006|IFNA4_HORSE Interferon alpha-4 OS=Equus caballus PE=3 ... 32 0.99
sp|P05005|IFNA3_HORSE Interferon alpha-3 OS=Equus caballus PE=3 ... 32 0.99
sp|P05004|IFNA2_HORSE Interferon alpha-2 OS=Equus caballus PE=3 ... 32 0.99
sp|P01570|IFN14_HUMAN Interferon alpha-14 OS=Homo sapiens GN=IFN... 32 1.3
sp|Q8BI21|RNF38_MOUSE RING finger protein 38 OS=Mus musculus GN=... 32 1.7
sp|Q9H0F5|RNF38_HUMAN RING finger protein 38 OS=Homo sapiens GN=... 32 1.7
sp|Q9NS56|TOPRS_HUMAN E3 ubiquitin-protein ligase Topors OS=Homo... 31 2.8
sp|Q7PC83|PDR13_ARATH Probable pleiotropic drug resistance prote... 31 2.9
sp|P01562|IFNA1_HUMAN Interferon alpha-1/13 OS=Homo sapiens GN=I... 31 2.9
sp|P05003|IFNA1_HORSE Interferon alpha-1 OS=Equus caballus PE=3 ... 31 2.9
sp|Q1QH69|ENGB_NITHX Probable GTP-binding protein engB OS=Nitrob... 30 3.8
sp|Q7T3T9|ZAR1_FUGRU Zygote arrest protein 1 OS=Fugu rubripes GN... 30 4.8
sp|Q8CIB9|ESCO2_MOUSE N-acetyltransferase ESCO2 OS=Mus musculus ... 29 8.2

>sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens
GN=ZNF311 PE=1 SV=2
Length = 666

Score = 32.3 bits (72), Expect = 0.99
Identities = 14/33 (42%), Positives = 21/33 (63%)
Frame = -1

Query: 381 QRRREDKTGEAKATCQKGISCKVLKEGHQPNLK 283
++ RE+K G + TC+KG + KVL + PN K
Sbjct: 201 EKLREEKEGSEEVTCKKGKNQKVLSKNLNPNSK 233


>sp|P05006|IFNA4_HORSE Interferon alpha-4 OS=Equus caballus PE=3
SV=1
Length = 184

Score = 32.3 bits (72), Expect = 0.99
Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
Frame = -1

Query: 189 SCGSGCPYQHTHSLLTIRRGSLVHLQVKIQ--SCL-DQENRDFPERGSKGNRF 40
SC GC HTHSL R L+ +I SCL D+ + FP+ GN+F
Sbjct: 19 SCSLGCDLPHTHSLGNTRVLMLLGQMRRISPFSCLKDRNDFGFPQEVFDGNQF 71


>sp|P05005|IFNA3_HORSE Interferon alpha-3 OS=Equus caballus PE=3
SV=1
Length = 184

Score = 32.3 bits (72), Expect = 0.99
Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
Frame = -1

Query: 189 SCGSGCPYQHTHSLLTIRRGSLVHLQVKIQ--SCL-DQENRDFPERGSKGNRF 40
SC GC HTHSL R L+ +I SCL D+ + FP+ GN+F
Sbjct: 19 SCSLGCDLPHTHSLGNTRVLMLLGQMRRISPFSCLKDRNDFGFPQEVFDGNQF 71


>sp|P05004|IFNA2_HORSE Interferon alpha-2 OS=Equus caballus PE=3
SV=1
Length = 184

Score = 32.3 bits (72), Expect = 0.99
Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
Frame = -1

Query: 189 SCGSGCPYQHTHSLLTIRRGSLVHLQVKIQ--SCL-DQENRDFPERGSKGNRF 40
SC GC HTHSL R L+ +I SCL D+ + FP+ GN+F
Sbjct: 19 SCSLGCDLPHTHSLGNTRVLMLLGQMRRISPFSCLKDRNDFGFPQEVFDGNQF 71


>sp|P01570|IFN14_HUMAN Interferon alpha-14 OS=Homo sapiens GN=IFNA14
PE=1 SV=3
Length = 189

Score = 32.0 bits (71), Expect = 1.3
Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
Frame = -1

Query: 195 RKSCGSGCPYQHTHSLLTIRRGSLVHLQVKIQ--SCL-DQENRDFPERGSKGNRF 40
+ SC GC THSL R L+ +I SCL D+ + +FP+ GN+F
Sbjct: 17 KSSCSLGCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQF 71


>sp|Q8BI21|RNF38_MOUSE RING finger protein 38 OS=Mus musculus
GN=Rnf38 PE=2 SV=1
Length = 518

Score = 31.6 bits (70), Expect = 1.7
Identities = 30/98 (30%), Positives = 38/98 (38%), Gaps = 18/98 (18%)
Frame = +3

Query: 150 NCVCVGKDIRYHNSFCPVSYSVPTFASRH*TNGFPL---------------GLLAFLSS- 281
N V V + H PVSY+V T A +G PL G S
Sbjct: 184 NAVMVDIHDQLHQGTVPVSYTVTTVA----PHGLPLCTGQHIPACSTQQVPGCSVVFSGQ 239

Query: 282 --PLGSVDDPLLELCS*FPFGMLPLPHLFCPPFSSGSP 389
P+ SV P+L+ CS LP+P+ PP S P
Sbjct: 240 HLPVCSVPPPMLQACS---VQHLPVPYAAFPPLISSDP 274


>sp|Q9H0F5|RNF38_HUMAN RING finger protein 38 OS=Homo sapiens
GN=RNF38 PE=1 SV=4
Length = 515

Score = 31.6 bits (70), Expect = 1.7
Identities = 30/98 (30%), Positives = 38/98 (38%), Gaps = 18/98 (18%)
Frame = +3

Query: 150 NCVCVGKDIRYHNSFCPVSYSVPTFASRH*TNGFPL---------------GLLAFLSS- 281
N V V + H PVSY+V T A +G PL G S
Sbjct: 181 NAVMVDIHDQLHQGTVPVSYTVTTVA----PHGIPLCTGQHIPACSTQQVPGCSVVFSGQ 236

Query: 282 --PLGSVDDPLLELCS*FPFGMLPLPHLFCPPFSSGSP 389
P+ SV P+L+ CS LP+P+ PP S P
Sbjct: 237 HLPVCSVPPPMLQACS---VQHLPVPYAAFPPLISSDP 271


>sp|Q9NS56|TOPRS_HUMAN E3 ubiquitin-protein ligase Topors OS=Homo
sapiens GN=TOPORS PE=1 SV=1
Length = 1045

Score = 30.8 bits (68), Expect = 2.8
Identities = 20/63 (31%), Positives = 27/63 (42%)
Frame = -3

Query: 451 QSRHIEGTPITAQPMLPEAAKGLPEEKGGQNR*GKGNMPKGNQLQSSKRGSSTEPKGEER 272
++RH+EGT AQP A+K + GN + S R S E K + R
Sbjct: 799 KTRHLEGTNEVAQPSREFASKAKDSHYQKSSSKLDGNYKNESDTFSDSRSSDRETKHKRR 858

Query: 271 KAK 263
K K
Sbjct: 859 KRK 861


>sp|Q7PC83|PDR13_ARATH Probable pleiotropic drug resistance protein
13 OS=Arabidopsis thaliana GN=PDR13 PE=2 SV=1
Length = 1397

Score = 30.8 bits (68), Expect = 2.9
Identities = 17/58 (29%), Positives = 30/58 (51%)
Frame = -1

Query: 288 LKAKKGKPKDLEETRLSSVC*QRWELSRKPGRKSCGSGCPYQHTHSLLTIRRGSLVHL 115
LK + KP D +TR S+C +++ LS+ K+C +L ++R S ++L
Sbjct: 460 LKEELSKPFDKSQTRKDSLCFRKYSLSKWEMLKACS-------RREILLMKRNSFIYL 510


>sp|P01562|IFNA1_HUMAN Interferon alpha-1/13 OS=Homo sapiens
GN=IFNA1 PE=1 SV=1
Length = 189

Score = 30.8 bits (68), Expect = 2.9
Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 3/55 (5%)
Frame = -1

Query: 195 RKSCGSGCPYQHTHSLLTIRRGSLVHLQVKI--QSCL-DQENRDFPERGSKGNRF 40
+ SC GC THSL R L+ +I SCL D+ + FP+ GN+F
Sbjct: 17 KSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQF 71


tr_hit_id A5K4S8
Definition tr|A5K4S8|A5K4S8_PLAVI Putative uncharacterized protein OS=Plasmodium vivax
Align length 137
Score (bit) 39.3
E-value 0.099
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918992|Adiantum capillus-veneris mRNA, clone:
YMU001_000119_H04.
(453 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5K4S8|A5K4S8_PLAVI Putative uncharacterized protein OS=Plasm... 39 0.099
tr|Q95J78|Q95J78_SAGOE Interferon-alpha OS=Saguinus oedipus GN=i... 34 3.2
tr|Q7MRN8|Q7MRN8_WOLSU Putative uncharacterized protein OS=Wolin... 34 4.2
tr|B8J2A9|B8J2A9_DESDE Putative uncharacterized protein OS=Desul... 33 7.1
tr|Q1PCX2|Q1PCX2_CERAE Interferon alpha (Fragment) OS=Cercopithe... 33 9.3

>tr|A5K4S8|A5K4S8_PLAVI Putative uncharacterized protein OS=Plasmodium
vivax GN=PVX_091955 PE=4 SV=1
Length = 1057

Score = 39.3 bits (90), Expect = 0.099
Identities = 37/137 (27%), Positives = 60/137 (43%), Gaps = 8/137 (5%)
Frame = -1

Query: 402 QKLLKDCQRRREDKTGEAKATCQKGISCKVLKEGHQPNL--KAKKGKPKDLEETRLSSVC 229
+K K + R+ K ++K KG K K + + K+KK K K ++T+ + V
Sbjct: 881 RKEAKKKSKERKSKGEKSKREKSKGEKSKREKSKGEKSKREKSKKEKSKKTKKTKPTKVK 940

Query: 228 *QRWELSRKPGRKSCGSGCPYQHTHSLLTIRRGSLVHLQVKI------QSCLDQENRDFP 67
++ + ++ K G PY H HS R S V V+ S +D+ + F
Sbjct: 941 PKKVKPTKMKSPKKTHDGTPYSHRHS---SRSRSSVGSSVESSRSHSESSSMDKSMKHFS 997

Query: 66 ERGSKGNRFPIQAQRSR 16
+GSKG A+R R
Sbjct: 998 AKGSKGKAHKRDARRRR 1014


>tr|Q95J78|Q95J78_SAGOE Interferon-alpha OS=Saguinus oedipus
GN=ifn-alpha PE=3 SV=1
Length = 189

Score = 34.3 bits (77), Expect = 3.2
Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 3/66 (4%)
Frame = -1

Query: 195 RKSCGSGCPYQHTHSLLTIRRGSLVHLQVKIQ--SCL-DQENRDFPERGSKGNRFPIQAQ 25
+ SC GC THSL R L+ +I SCL D+ + +FP+ GN+F Q
Sbjct: 17 KSSCSLGCDLPQTHSLGNRRTLMLLAQMRRISPFSCLKDRRDFEFPQEEFDGNQF----Q 72

Query: 24 RSRATF 7
++RA F
Sbjct: 73 KARAIF 78


>tr|Q7MRN8|Q7MRN8_WOLSU Putative uncharacterized protein
OS=Wolinella succinogenes GN=WS1163 PE=4 SV=1
Length = 100

Score = 33.9 bits (76), Expect = 4.2
Identities = 16/39 (41%), Positives = 22/39 (56%)
Frame = +3

Query: 330 PFGMLPLPHLFCPPFSSGSPLAASGSMG*AVMGVPSMCL 446
P GM P+PHL P G+P GS+ A+MG +C+
Sbjct: 18 PTGMNPIPHLGGPILGPGAPTVLIGSLPAALMGDDCVCV 56


>tr|B8J2A9|B8J2A9_DESDE Putative uncharacterized protein
OS=Desulfovibrio desulfuricans subsp. desulfuricans str.
ATCC 27774 GN=Ddes_1872 PE=3 SV=1
Length = 265

Score = 33.1 bits (74), Expect = 7.1
Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 8/91 (8%)
Frame = +3

Query: 198 PVSYSVPTFASRH*TNGFPLG---LLAFLSSPLGSVDDPLLELCS*FPFGMLPLPHLFCP 368
P + S+P FA T+G LG L +F+ G++ P + C+ +PL H
Sbjct: 130 PATRSMPGFAG---TSGVGLGIGLLSSFVGIGGGTISVPFMTTCN------VPLHHAVGT 180

Query: 369 PFSSGSPLAASGSMG*AVMG-----VPSMCL 446
+ G P+A +G++G V G +PSM L
Sbjct: 181 SAAIGFPIAVAGTLGYIVGGWGRPDLPSMAL 211


>tr|Q1PCX2|Q1PCX2_CERAE Interferon alpha (Fragment) OS=Cercopithecus
aethiops PE=2 SV=1
Length = 74

Score = 32.7 bits (73), Expect = 9.3
Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 4/56 (7%)
Frame = -1

Query: 195 RKSCGSGCPYQHTHSLLTIRRGSLVHLQVKI--QSCLDQENR--DFPERGSKGNRF 40
+ C GC THSL R L+ +I SC D +N DFP++ GN+F
Sbjct: 17 KSGCSLGCDLPETHSLDNRRTMMLLKQMSRISPSSCSDGQNMTLDFPQQEFDGNQF 72