BP919004
Clone id YMU001_000120_A05
Library
Length 569
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000120_A05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTACACTTCTCAAAGTCTGCATCTATCCAGACTTCCAGAGAAGGGACTCACAACCATTTT
ACATCCCTCCAAATCTGCTTTTGTTGGAAGTGTCAACAATGCTATTGGATGGCTTGACCT
CCTCAAGGGAACGGTATTCACACCAATTTCCTTCAGCAAAAAAAATTCCAGCTTCTTCTT
CACCGTCTCAACCTCCTGGCTGTAGTTACTTGCTTACAGAAATCTCTTCGATTTGCCTGC
GTTCAGTACTTTTCTGCAAAACAAATAGCCTTCTATAATGAGGTGCATGGACTCTGCCAT
CATTTCAGTGTTGGCTCGTCCTTCACTCTCGAGTAGTGGCCTCATAAATCTCTTCTAGAT
GTCGAGATATTGTGTCATCAAGTAGCTGCATTGCTCTTTGTTGTCGTGCATCTTGAGGGA
CATGTCCAGACCCATTGCTATAATGGTCAATCCTGCACCGACCCAAGGCAACGCATCCAA
GGCACTGACAAATTCCTTTGAAAGCTTAGCTCCAGCGGTGACCTTGTCCAGATGTTTCTC
CACATACAATGCATAACTTTTCACATCAT
■■Homology search results ■■ -
sp_hit_id Q7T2X7
Definition sp|Q7T2X7|BMP3_XENLA Bone morphogenetic protein 3 OS=Xenopus laevis
Align length 58
Score (bit) 33.1
E-value 0.99
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919004|Adiantum capillus-veneris mRNA, clone:
YMU001_000120_A05.
(569 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q7T2X7|BMP3_XENLA Bone morphogenetic protein 3 OS=Xenopus lae... 33 0.99
sp|Q80U30|CL16A_MOUSE Protein CLEC16A OS=Mus musculus GN=Clec16a... 33 1.3
sp|Q2KHT3|CL16A_HUMAN Protein CLEC16A OS=Homo sapiens GN=CLEC16A... 33 1.3

>sp|Q7T2X7|BMP3_XENLA Bone morphogenetic protein 3 OS=Xenopus laevis
GN=bmp3 PE=1 SV=1
Length = 458

Score = 33.1 bits (74), Expect = 0.99
Identities = 20/58 (34%), Positives = 27/58 (46%)
Frame = -2

Query: 514 WS*AFKGICQCLGCVALGRCRIDHYSNGSGHVPQDARQQRAMQLLDDTISRHLEEIYE 341
W + G C CL C+ALG D ARQ+ A L DT+S H+ +Y+
Sbjct: 7 WLVLWVGCCGCL-CLALGELLNDGLLAVGMGTGDAARQEEAALPLGDTVSEHMLRLYD 63


>sp|Q80U30|CL16A_MOUSE Protein CLEC16A OS=Mus musculus GN=Clec16a
PE=2 SV=2
Length = 1036

Score = 32.7 bits (73), Expect = 1.3
Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 1/77 (1%)
Frame = +1

Query: 217 QKSLRFACVQYFSAKQIAFYNEVHGLCHHFSVGSSFTLE*WPHK-SLLDVEILCHQVAAL 393
QKS R+ CVQ I F N H ++ + +++ HK D EI+ + ++ L
Sbjct: 87 QKSGRYVCVQLLQTLNILFENISHETSLYYLLSNNYVNSIIVHKFDFSDEEIMAYYISFL 146

Query: 394 LFVVVHLEGHVQTHCYN 444
+ + L H YN
Sbjct: 147 KTLSLKLNNHTVHFFYN 163


>sp|Q2KHT3|CL16A_HUMAN Protein CLEC16A OS=Homo sapiens GN=CLEC16A
PE=2 SV=2
Length = 1053

Score = 32.7 bits (73), Expect = 1.3
Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 1/77 (1%)
Frame = +1

Query: 217 QKSLRFACVQYFSAKQIAFYNEVHGLCHHFSVGSSFTLE*WPHK-SLLDVEILCHQVAAL 393
QKS R+ CVQ I F N H ++ + +++ HK D EI+ + ++ L
Sbjct: 87 QKSGRYVCVQLLQTLNILFENISHETSLYYLLSNNYVNSIIVHKFDFSDEEIMAYYISFL 146

Query: 394 LFVVVHLEGHVQTHCYN 444
+ + L H YN
Sbjct: 147 KTLSLKLNNHTVHFFYN 163


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919004|Adiantum capillus-veneris mRNA, clone:
YMU001_000120_A05.
(569 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******