BP919025
Clone id YMU001_000120_C04
Library
Length 253
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000120_C04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCTTCAACCACTTCACCCTCTTTGTAAAATCCCTGTAAGGTTCATTCTGGATGGGCCTTG
AATCCACACATATGAGACGATTCAACATCTCGGACTTCTGAACCCCATATGTATTAGACA
AGTTGTCCTGAAGCTCTTCATACGAATCAAAAAGGGAGAGATCAACAGTGGCTGGACAGG
TTTCGCCACCCACTCCATATGGGCAACTCTGCTCAAATGAACCATTTGTAGTCCCTACAC
TCCTTGCTTGGTG
■■Homology search results ■■ -
sp_hit_id Q9AV47
Definition sp|Q9AV47|ARFV_ORYSJ Auxin response factor 22 OS=Oryza sativa subsp. japonica
Align length 87
Score (bit) 47.4
E-value 2.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919025|Adiantum capillus-veneris mRNA, clone:
YMU001_000120_C04.
(253 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9AV47|ARFV_ORYSJ Auxin response factor 22 OS=Oryza sativa su... 47 2e-05
sp|Q93YR9|ARFP_ARATH Auxin response factor 16 OS=Arabidopsis tha... 47 4e-05
sp|Q653H7|ARFR_ORYSJ Auxin response factor 18 OS=Oryza sativa su... 43 6e-04
sp|Q9SKN5|ARFJ_ARATH Auxin response factor 10 OS=Arabidopsis tha... 37 0.040
sp|Q7XKK6|ARFJ_ORYSJ Auxin response factor 10 OS=Oryza sativa su... 32 0.75
sp|Q01I35|ARFJ_ORYSI Auxin responsive factor 10 OS=Oryza sativa ... 32 0.75
sp|Q97EH0|RPOC_CLOAB DNA-directed RNA polymerase subunit beta' O... 31 1.7
sp|Q6K223|ARFH_ORYSJ Auxin response factor 8 OS=Oryza sativa sub... 31 1.7
sp|Q7V9I9|SYV_PROMA Valyl-tRNA synthetase OS=Prochlorococcus mar... 29 6.3
sp|Q91XT4|SC16B_MOUSE Protein transport protein Sec16B OS=Mus mu... 29 8.3

>sp|Q9AV47|ARFV_ORYSJ Auxin response factor 22 OS=Oryza sativa
subsp. japonica GN=ARF22 PE=2 SV=1
Length = 698

Score = 47.4 bits (111), Expect = 2e-05
Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 4/87 (4%)
Frame = -1

Query: 253 HQARSVGTTNGSFEQSCPYGVGGETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRL 74
H+A +G G C + E T+DLS+F SYEEL L++ +G++K E++N L
Sbjct: 594 HEASDLGLEAGH----CKVFMESEDVGRTIDLSVFGSYEELYGRLADMFGIEKEEIINHL 649

Query: 73 ICVDSRPIQNE----PYRDFTKRVKWL 5
D+ + P+ DF K + L
Sbjct: 650 HFRDAAGVVKHPGEVPFSDFMKAARRL 676


>sp|Q93YR9|ARFP_ARATH Auxin response factor 16 OS=Arabidopsis
thaliana GN=ARF16 PE=2 SV=1
Length = 670

Score = 46.6 bits (109), Expect = 4e-05
Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 4/85 (4%)
Frame = -1

Query: 247 ARSVGTTNGSFEQSCPYGVGGETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRLIC 68
++ V +G C + + T+DLS+ SYEEL LS+ +G++KSEML+ ++
Sbjct: 573 SKKVHDASGLETGHCKVFMESDDVGRTLDLSVLGSYEELSRKLSDMFGIKKSEMLSSVLY 632

Query: 67 VDS----RPIQNEPYRDFTKRVKWL 5
D+ + NEP+ +F K + L
Sbjct: 633 RDASGAIKYAGNEPFSEFLKTARRL 657


>sp|Q653H7|ARFR_ORYSJ Auxin response factor 18 OS=Oryza sativa
subsp. japonica GN=ARF18 PE=2 SV=1
Length = 700

Score = 42.7 bits (99), Expect = 6e-04
Identities = 22/71 (30%), Positives = 41/71 (57%), Gaps = 4/71 (5%)
Frame = -1

Query: 205 CPYGVGGETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRLICVDS----RPIQNEP 38
C + E T+DLS+ SYEEL L++ +G++K+E+++ + D+ + +EP
Sbjct: 617 CKVFMQSEDVGRTLDLSVVGSYEELYRRLADMFGIEKAELMSHVFYRDAAGALKHTGDEP 676

Query: 37 YRDFTKRVKWL 5
+ +FTK + L
Sbjct: 677 FSEFTKTARRL 687


>sp|Q9SKN5|ARFJ_ARATH Auxin response factor 10 OS=Arabidopsis
thaliana GN=ARF10 PE=2 SV=1
Length = 693

Score = 36.6 bits (83), Expect = 0.040
Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 5/72 (6%)
Frame = -1

Query: 205 CPYGVGGETCPATVDLSLFDSYEELQDNLSNTYGV-QKSEMLNRLICVDS----RPIQNE 41
C + E T+DLS+ SY+EL L+ + + ++S++L ++ D+ + I +E
Sbjct: 583 CKVFMESEDVGRTLDLSVIGSYQELYRKLAEMFHIEERSDLLTHVVYRDANGVIKRIGDE 642

Query: 40 PYRDFTKRVKWL 5
P+ DF K K L
Sbjct: 643 PFSDFMKATKRL 654


>sp|Q7XKK6|ARFJ_ORYSJ Auxin response factor 10 OS=Oryza sativa
subsp. japonica GN=ARF10 PE=2 SV=3
Length = 699

Score = 32.3 bits (72), Expect = 0.75
Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 4/72 (5%)
Frame = -1

Query: 205 CPYGVGGETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRLI----CVDSRPIQNEP 38
C V ET ++DLS S+EEL LS+ + + E+ + L+ + + +EP
Sbjct: 616 CKVFVESETVGRSLDLSALSSFEELYACLSDMFSIGSDELRSHLVYRSPAGEVKHAGDEP 675

Query: 37 YRDFTKRVKWLK 2
+ F K + L+
Sbjct: 676 FCAFVKSARKLR 687


>sp|Q01I35|ARFJ_ORYSI Auxin responsive factor 10 OS=Oryza sativa
subsp. indica GN=ARF10 PE=2 SV=2
Length = 699

Score = 32.3 bits (72), Expect = 0.75
Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 4/72 (5%)
Frame = -1

Query: 205 CPYGVGGETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRLI----CVDSRPIQNEP 38
C V ET ++DLS S+EEL LS+ + + E+ + L+ + + +EP
Sbjct: 616 CKVFVESETVGRSLDLSALSSFEELYACLSDMFSIGSDELRSHLVYRSPAGEVKHAGDEP 675

Query: 37 YRDFTKRVKWLK 2
+ F K + L+
Sbjct: 676 FCAFVKSARKLR 687


>sp|Q97EH0|RPOC_CLOAB DNA-directed RNA polymerase subunit beta'
OS=Clostridium acetobutylicum GN=rpoC PE=3 SV=1
Length = 1182

Score = 31.2 bits (69), Expect = 1.7
Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
Frame = -1

Query: 214 EQSCPYGVGGETCPATV-DLSLFDSYEELQDNLSNTYGVQKSEMLNRLICVDSRPIQNEP 38
E+S G+G E+ + ++ L EEL++NL + G +K ++ RL V+S
Sbjct: 163 EESFEAGMGAESIKKLLQEIDLNQLSEELKENLKTSTGQKKVRIIRRLEVVES------- 215

Query: 37 YRDFTKRVKWL 5
+R T + +W+
Sbjct: 216 FRKSTNKPEWM 226


>sp|Q6K223|ARFH_ORYSJ Auxin response factor 8 OS=Oryza sativa subsp.
japonica GN=ARF8 PE=2 SV=1
Length = 681

Score = 31.2 bits (69), Expect = 1.7
Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 4/71 (5%)
Frame = -1

Query: 205 CPYGVGGETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRLI----CVDSRPIQNEP 38
C + +T +DLS S+E+L LS + + +E+ +R++ + R +EP
Sbjct: 598 CKVFIESDTVGRNLDLSSLASFEQLYGRLSEMFCIDSAELRSRVLYRGATGEVRHAGDEP 657

Query: 37 YRDFTKRVKWL 5
+ +F K + L
Sbjct: 658 FSEFIKLARRL 668


>sp|Q7V9I9|SYV_PROMA Valyl-tRNA synthetase OS=Prochlorococcus
marinus GN=valS PE=3 SV=1
Length = 933

Score = 29.3 bits (64), Expect = 6.3
Identities = 11/31 (35%), Positives = 18/31 (58%)
Frame = -2

Query: 180 PVQPLLISPFLIRMKSFRTTCLIHMGFRSPR 88
P++PLL + + +RM+ C H+G PR
Sbjct: 369 PIEPLLSTQWFVRMEPMAERCRSHLGKDEPR 399


>sp|Q91XT4|SC16B_MOUSE Protein transport protein Sec16B OS=Mus
musculus GN=Sec16b PE=1 SV=2
Length = 1051

Score = 28.9 bits (63), Expect = 8.3
Identities = 16/55 (29%), Positives = 23/55 (41%)
Frame = -1

Query: 199 YGVGGETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRLICVDSRPIQNEPY 35
YG GG T DLS +Y E + S + + L + S P+Q + Y
Sbjct: 722 YGAGGTTDTPYPDLSGHQNYSEDSEYSSTLWSTAEQTSLTNPLAQQSFPLQRDTY 776


tr_hit_id Q4VDC9
Definition tr|Q4VDC9|Q4VDC9_9FILI F-160-1_1 (Fragment) OS=Ceratopteris thalictroides
Align length 70
Score (bit) 110.0
E-value 4.0e-23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919025|Adiantum capillus-veneris mRNA, clone:
YMU001_000120_C04.
(253 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4VDC9|Q4VDC9_9FILI F-160-1_1 (Fragment) OS=Ceratopteris thal... 110 4e-23
tr|B8BHI0|B8BHI0_ORYSI Putative uncharacterized protein OS=Oryza... 47 4e-04
tr|A7NZK3|A7NZK3_VITVI Chromosome chr6 scaffold_3, whole genome ... 47 6e-04
tr|A7PI39|A7PI39_VITVI Chromosome chr13 scaffold_17, whole genom... 46 8e-04
tr|A3C5S9|A3C5S9_ORYSJ Putative uncharacterized protein OS=Oryza... 45 0.001
tr|A7PT37|A7PT37_VITVI Chromosome chr8 scaffold_29, whole genome... 45 0.002
tr|Q4VDB9|Q4VDB9_9BRYO M-160-2_1 (Fragment) OS=Polytrichum junip... 44 0.005
tr|Q4VDC0|Q4VDC0_9BRYO M-160-1_1 (Fragment) OS=Polytrichum junip... 43 0.007
tr|A5BUC2|A5BUC2_VITVI Putative uncharacterized protein OS=Vitis... 43 0.007
tr|B7EQA3|B7EQA3_ORYSJ cDNA clone:J023079H12, full insert sequen... 43 0.009
tr|A3BES8|A3BES8_ORYSJ Putative uncharacterized protein OS=Oryza... 43 0.009
tr|A9TVV9|A9TVV9_PHYPA Predicted protein OS=Physcomitrella paten... 42 0.015
tr|A9TVW0|A9TVW0_PHYPA Predicted protein OS=Physcomitrella paten... 41 0.026
tr|A4L9W4|A4L9W4_GOSHI Auxin response factor 3 OS=Gossypium hirs... 40 0.059
tr|B8A249|B8A249_MAIZE Putative uncharacterized protein OS=Zea m... 39 0.100
tr|B6DXL3|B6DXL3_MALDO Putative auxin response factor ARF16 OS=M... 39 0.100
tr|Q0WQZ3|Q0WQZ3_ARATH Putative uncharacterized protein At2g2835... 36 0.85
tr|B8B1S2|B8B1S2_ORYSI Putative uncharacterized protein OS=Oryza... 35 1.9

>tr|Q4VDC9|Q4VDC9_9FILI F-160-1_1 (Fragment) OS=Ceratopteris
thalictroides GN=f-160-1 PE=2 SV=1
Length = 278

Score = 110 bits (275), Expect = 4e-23
Identities = 52/70 (74%), Positives = 58/70 (82%)
Frame = -1

Query: 211 QSCPYGVGGETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRLICVDSRPIQNEPYR 32
+ C + VG TC A VDLSLF+SYEELQ+NLS YG QKSEM NRLICVDSRPI+NEPYR
Sbjct: 197 RDCVFAVGKGTCQAAVDLSLFNSYEELQENLSKAYGFQKSEMFNRLICVDSRPIENEPYR 256

Query: 31 DFTKRVKWLK 2
DFT+RVK LK
Sbjct: 257 DFTRRVKCLK 266


>tr|B8BHI0|B8BHI0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_34050 PE=4 SV=1
Length = 690

Score = 47.4 bits (111), Expect = 4e-04
Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 4/87 (4%)
Frame = -1

Query: 253 HQARSVGTTNGSFEQSCPYGVGGETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRL 74
H+A +G G C + E T+DLS+F SYEEL L++ +G++K E++N L
Sbjct: 586 HEASDLGLEAGH----CKVFMESEDVGRTIDLSVFGSYEELYGRLADMFGIEKEEIINHL 641

Query: 73 ICVDSRPIQNE----PYRDFTKRVKWL 5
D+ + P+ DF K + L
Sbjct: 642 HFHDAAGVVKHPGEVPFSDFMKAARRL 668


>tr|A7NZK3|A7NZK3_VITVI Chromosome chr6 scaffold_3, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00024547001
PE=4 SV=1
Length = 687

Score = 46.6 bits (109), Expect = 6e-04
Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 4/71 (5%)
Frame = -1

Query: 205 CPYGVGGETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRLICVDS----RPIQNEP 38
C + E ++DLS+ SYEEL L+N +G+++SE + ++ D+ + +EP
Sbjct: 578 CKVFMESEDVGRSLDLSVLGSYEELYTRLANMFGIERSETFSHVLYRDATGAVKHTGDEP 637

Query: 37 YRDFTKRVKWL 5
+ DFTK+ K L
Sbjct: 638 FSDFTKKAKRL 648


>tr|A7PI39|A7PI39_VITVI Chromosome chr13 scaffold_17, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00018183001
PE=4 SV=1
Length = 683

Score = 46.2 bits (108), Expect = 8e-04
Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 4/87 (4%)
Frame = -1

Query: 253 HQARSVGTTNGSFEQSCPYGVGGETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRL 74
HQ ++G G C + E T+DLS+ SYEEL L+N +G++++EML+ +
Sbjct: 591 HQKTNLGLETGH----CKVFMESEDVGRTLDLSILGSYEELYRKLANMFGIERAEMLSNV 646

Query: 73 ICVDS----RPIQNEPYRDFTKRVKWL 5
+ D + I + P+ +F K + L
Sbjct: 647 LYRDEAGIVKHIGDAPFGEFLKTARRL 673


>tr|A3C5S9|A3C5S9_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_030651 PE=4 SV=1
Length = 729

Score = 45.4 bits (106), Expect = 0.001
Identities = 24/72 (33%), Positives = 38/72 (52%)
Frame = -1

Query: 253 HQARSVGTTNGSFEQSCPYGVGGETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRL 74
H+A +G G C + E T+DLS+F SYEEL L++ +G++K E++N L
Sbjct: 656 HEASDLGLEAGH----CKVFMESEDVGRTIDLSVFGSYEELYGRLADMFGIEKEEIINHL 711

Query: 73 ICVDSRPIQNEP 38
D+ + P
Sbjct: 712 HFRDAAGVVKHP 723


>tr|A7PT37|A7PT37_VITVI Chromosome chr8 scaffold_29, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023198001
PE=4 SV=1
Length = 675

Score = 45.1 bits (105), Expect = 0.002
Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 4/71 (5%)
Frame = -1

Query: 205 CPYGVGGETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRLICVDS----RPIQNEP 38
C + E T+DLSL SY+EL L+ + ++ SEM N ++ D+ + I +EP
Sbjct: 589 CKVFMESEDVGRTLDLSLLTSYDELCGKLAKMFTIEDSEMRNHVLYRDATGAVKHIGDEP 648

Query: 37 YRDFTKRVKWL 5
+ DFTK K L
Sbjct: 649 FSDFTKTAKRL 659


>tr|Q4VDB9|Q4VDB9_9BRYO M-160-2_1 (Fragment) OS=Polytrichum
juniperinum GN=m-160-2 PE=2 SV=1
Length = 316

Score = 43.5 bits (101), Expect = 0.005
Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 4/65 (6%)
Frame = -1

Query: 187 GETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRLICVDSR----PIQNEPYRDFTK 20
GE T+D+S F SYEEL L +GV + +R + D++ + NEPYR F +
Sbjct: 240 GEEVGRTLDMSSFTSYEELYSRLETIFGVSQLHFQDRAVYRDAQGSTMHVGNEPYRSFMQ 299

Query: 19 RVKWL 5
V+ L
Sbjct: 300 TVRRL 304


>tr|Q4VDC0|Q4VDC0_9BRYO M-160-1_1 (Fragment) OS=Polytrichum
juniperinum GN=m-160-1 PE=2 SV=1
Length = 308

Score = 43.1 bits (100), Expect = 0.007
Identities = 24/65 (36%), Positives = 39/65 (60%), Gaps = 4/65 (6%)
Frame = -1

Query: 187 GETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRLICVDS----RPIQNEPYRDFTK 20
GE T+DLS+F SY EL + L+ + V S+ +R++ D+ + + +EPYR+F K
Sbjct: 229 GEEVGRTLDLSIFTSYYELFNRLAAMFSVPTSKFEHRVVYQDAEGSMKHVGDEPYRNFVK 288

Query: 19 RVKWL 5
V+ L
Sbjct: 289 AVRRL 293


>tr|A5BUC2|A5BUC2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024151 PE=4 SV=1
Length = 680

Score = 43.1 bits (100), Expect = 0.007
Identities = 23/68 (33%), Positives = 37/68 (54%)
Frame = -1

Query: 253 HQARSVGTTNGSFEQSCPYGVGGETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRL 74
HQ ++G G C + E T+DLS+ SYEEL L+N +G++++EML+ +
Sbjct: 607 HQKTNLGLETGH----CKVFMESEDVGRTLDLSILGSYEELYRKLANMFGIERAEMLSNV 662

Query: 73 ICVDSRPI 50
+ D I
Sbjct: 663 LYRDEAGI 670


>tr|B7EQA3|B7EQA3_ORYSJ cDNA clone:J023079H12, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 700

Score = 42.7 bits (99), Expect = 0.009
Identities = 22/71 (30%), Positives = 41/71 (57%), Gaps = 4/71 (5%)
Frame = -1

Query: 205 CPYGVGGETCPATVDLSLFDSYEELQDNLSNTYGVQKSEMLNRLICVDS----RPIQNEP 38
C + E T+DLS+ SYEEL L++ +G++K+E+++ + D+ + +EP
Sbjct: 617 CKVFMQSEDVGRTLDLSVVGSYEELYRRLADMFGIEKAELMSHVFYRDAAGALKHTGDEP 676

Query: 37 YRDFTKRVKWL 5
+ +FTK + L
Sbjct: 677 FSEFTKTARRL 687