BP919041
Clone id YMU001_000120_E01
Library
Length 485
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000120_E01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AACGAGGCATTTGCAACATCCAATTGCACTTGAATTTTTTGAGCTGACAGGGATGTCGTA
AGAAGTTCATTCGTAACATCTGTCAGCTGCTCGTCTTTTACTTTGCAGGTATTGGATAAT
TTAGTGAGCAGATCACCTAGCTCTTCCATTTCTTTTTGCTGCCTACCTCTAGCGGGCTGA
TGCTGTTCAGCTTCTGCTTTCATCTCCTACACCTATCTCTGAAGATCGGTGATGAGATAG
TCATCCTGTCTTCTAGCTCTCCTTGGAGAGCGTCAATCACCATTTCAAGCTCTTTGGAAT
TTGTGTTGTGGCTAAGTGCTGGTGAACGTAGTCTCTCCGTCATGTCTTGCATCTACCTTG
CATATTCGTTTACTTGCAGTATAACCTCTTCATTTGACTGCCAATCCTCTTGTCTTGCCA
GTTGAGATGTGTTTGCAGCCTCATGTGTGTCTTTTGGCTACGTCGTAGCTGTTGTTTCTT
CTTGT
■■Homology search results ■■ -
sp_hit_id P38190
Definition sp|P38190|YBF3_YEAST Putative uncharacterized protein YBL053W OS=Saccharomyces cerevisiae
Align length 72
Score (bit) 35.0
E-value 0.18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919041|Adiantum capillus-veneris mRNA, clone:
YMU001_000120_E01.
(485 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P38190|YBF3_YEAST Putative uncharacterized protein YBL053W OS... 35 0.18
sp|O29215|Y1047_ARCFU Uncharacterized protein AF_1047 OS=Archaeo... 32 1.5
sp|O27350|GRPE_METTH Protein grpE OS=Methanobacterium thermoauto... 31 2.6
sp|Q4G0X9|CCD40_HUMAN Coiled-coil domain-containing protein 40 O... 30 4.4
sp|Q5T0U0|CC122_HUMAN Coiled-coil domain-containing protein 122 ... 30 4.4
sp|Q9MA92|FPP3_ARATH Filament-like plant protein 3 OS=Arabidopsi... 30 5.7
sp|A3KNB6|ODR4_XENLA Protein odr-4 homolog OS=Xenopus laevis GN=... 30 7.5
sp|Q54G05|LRRX1_DICDI Putative leucine-rich repeat-containing pr... 30 7.5
sp|Q8BVN0|CC122_MOUSE Coiled-coil domain-containing protein 122 ... 30 7.5
sp|Q8CG70|P3H3_MOUSE Prolyl 3-hydroxylase 3 OS=Mus musculus GN=L... 29 9.8
sp|Q8IVL6|P3H3_HUMAN Prolyl 3-hydroxylase 3 OS=Homo sapiens GN=L... 29 9.8
sp|Q0VNE8|EX7L_ALCBS Exodeoxyribonuclease 7 large subunit OS=Alc... 29 9.8

>sp|P38190|YBF3_YEAST Putative uncharacterized protein YBL053W
OS=Saccharomyces cerevisiae GN=YBL053W PE=5 SV=1
Length = 124

Score = 35.0 bits (79), Expect = 0.18
Identities = 26/72 (36%), Positives = 39/72 (54%)
Frame = +3

Query: 237 IVILSSSSPWRASITISSSLEFVLWLSAGERSLSVMSCIYLAYSFTCSITSSFDCQSSCL 416
I SSSS R + +L F++WLS S S SC +L S + S++SS+ SS
Sbjct: 13 IAAYSSSSSIRVIFLLFLTLSFLMWLSI---SFSSCSCPFLFPSSSSSLSSSYVSSSSSF 69

Query: 417 AS*DVFAASCVS 452
+S D+ ++S S
Sbjct: 70 SS-DICSSSMSS 80


>sp|O29215|Y1047_ARCFU Uncharacterized protein AF_1047
OS=Archaeoglobus fulgidus GN=AF_1047 PE=4 SV=1
Length = 214

Score = 32.0 bits (71), Expect = 1.5
Identities = 14/58 (24%), Positives = 32/58 (55%)
Frame = -1

Query: 194 EAEQHQPARGRQQKEMEELGDLLTKLSNTCKVKDEQLTDVTNELLTTSLSAQKIQVQL 21
E E+ + ++ E +E DL++ L+ + K+E+ D+ +L SA++++ +L
Sbjct: 142 EQEEEEEEEEVEEVEFDEEDDLISSLAKEVETKEEEEIDLLRDLKGQKFSAEELEAEL 199


>sp|O27350|GRPE_METTH Protein grpE OS=Methanobacterium
thermoautotrophicum GN=grpE PE=3 SV=1
Length = 174

Score = 31.2 bits (69), Expect = 2.6
Identities = 17/47 (36%), Positives = 26/47 (55%)
Frame = -1

Query: 158 QKEMEELGDLLTKLSNTCKVKDEQLTDVTNELLTTSLSAQKIQVQLD 18
QKE+EEL + L L N K K+E++ + T+ L Q++Q D
Sbjct: 16 QKELEELRERLKDLENEIKKKEEEVREYTSHL-------QRLQADFD 55


>sp|Q4G0X9|CCD40_HUMAN Coiled-coil domain-containing protein 40
OS=Homo sapiens GN=CCDC40 PE=2 SV=2
Length = 1142

Score = 30.4 bits (67), Expect = 4.4
Identities = 27/85 (31%), Positives = 37/85 (43%)
Frame = -2

Query: 478 ETTATT*PKDTHEAANTSQLARQEDWQSNEEVILQVNEYAR*MQDMTERLRSPALSHNTN 299
ET AT K T + T Q+A Q Q N Y +QD + L L
Sbjct: 559 ETEATLLQKLTTQCL-TKQVALQS----------QFNTYRLTLQDTEDALSQDQLEQMIL 607

Query: 298 SKELEMVIDALQGELEDRMTISSPI 224
++EL+ + A+QGELE R + I
Sbjct: 608 TEELQAIRQAIQGELELRRKTDAAI 632


>sp|Q5T0U0|CC122_HUMAN Coiled-coil domain-containing protein 122
OS=Homo sapiens GN=CCDC122 PE=2 SV=1
Length = 273

Score = 30.4 bits (67), Expect = 4.4
Identities = 13/37 (35%), Positives = 22/37 (59%)
Frame = -3

Query: 468 LRRSQKTHMRLQTHLNWQDKRIGSQMKRLYCK*TNMQ 358
L +KTH +L+ + Q KR + +KRL+C+ +Q
Sbjct: 209 LEEEKKTHEKLRKEIEVQHKRYDAILKRLHCQVNKLQ 245


>sp|Q9MA92|FPP3_ARATH Filament-like plant protein 3 OS=Arabidopsis
thaliana GN=FPP3 PE=2 SV=2
Length = 615

Score = 30.0 bits (66), Expect = 5.7
Identities = 16/47 (34%), Positives = 28/47 (59%)
Frame = -2

Query: 391 EEVILQVNEYAR*MQDMTERLRSPALSHNTNSKELEMVIDALQGELE 251
E +IL++ ++D+TE+ R+ + HN+ EL+ I L+ ELE
Sbjct: 516 ESLILKIKS----LEDVTEKERALSAKHNSKCNELQDEISKLKQELE 558


>sp|A3KNB6|ODR4_XENLA Protein odr-4 homolog OS=Xenopus laevis
GN=odr4 PE=2 SV=1
Length = 446

Score = 29.6 bits (65), Expect = 7.5
Identities = 15/79 (18%), Positives = 36/79 (45%)
Frame = -2

Query: 448 THEAANTSQLARQEDWQSNEEVILQVNEYAR*MQDMTERLRSPALSHNTNSKELEMVIDA 269
T++ + + DW+ V+ + D+T L SP+L++ K + + +
Sbjct: 151 TYDINDPKSTPKPADWKYQNSVLSWLTVDCNVRVDVTIPLTSPSLTYQERQKSIRLGLVK 210

Query: 268 LQGELEDRMTISSPIFRDR 212
E+ED + + + ++D+
Sbjct: 211 WTKEIEDSVVLFNGQYKDK 229


>sp|Q54G05|LRRX1_DICDI Putative leucine-rich repeat-containing
protein DDB_G0290503 OS=Dictyostelium discoideum
GN=DDB_G0290503 PE=4 SV=1
Length = 1492

Score = 29.6 bits (65), Expect = 7.5
Identities = 18/68 (26%), Positives = 37/68 (54%), Gaps = 8/68 (11%)
Frame = -1

Query: 188 EQHQPARGRQQKEMEELGDLLTKLSNTCKVKD-------EQLTDVTNELLTTSLSAQKIQ 30
+QH+ + + + EL D ++K+SN KD +Q D E+ ++ S+ ++Q
Sbjct: 369 QQHEIDNNKNNQMILELNDNISKISNQLNEKDNKIQELSKQSIDKQKEIENSTSSSDQLQ 428

Query: 29 VQL-DVAN 9
++L D++N
Sbjct: 429 LKLNDISN 436


>sp|Q8BVN0|CC122_MOUSE Coiled-coil domain-containing protein 122
OS=Mus musculus GN=Ccdc122 PE=2 SV=1
Length = 290

Score = 29.6 bits (65), Expect = 7.5
Identities = 13/42 (30%), Positives = 24/42 (57%)
Frame = -3

Query: 483 KKKQQLRRSQKTHMRLQTHLNWQDKRIGSQMKRLYCK*TNMQ 358
+K + +KTH +L+ + Q KR + +KRL+C+ +Q
Sbjct: 205 EKTSFVEEEKKTHEKLRKEIEVQHKRYDAILKRLHCQMNKIQ 246


>sp|Q8CG70|P3H3_MOUSE Prolyl 3-hydroxylase 3 OS=Mus musculus
GN=Leprel2 PE=2 SV=1
Length = 732

Score = 29.3 bits (64), Expect = 9.8
Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 6/57 (10%)
Frame = -2

Query: 361 AR*MQDMTERLRSPALSHNTNSKELEMVI------DALQGELEDRMTISSPIFRDRC 209
A+ + +++ER+R+ ++ + + L + A++GE E RM +S P+ D C
Sbjct: 528 AKLLLEVSERVRTLTQAYFSPERPLHLSFTHLVCRSAIEGEQEQRMDLSHPVHADNC 584


tr_hit_id B4IX74
Definition tr|B4IX74|B4IX74_DROGR GH16845 OS=Drosophila grimshawi
Align length 69
Score (bit) 37.4
E-value 0.37
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919041|Adiantum capillus-veneris mRNA, clone:
YMU001_000120_E01.
(485 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4IX74|B4IX74_DROGR GH16845 OS=Drosophila grimshawi GN=GH1684... 37 0.37
tr|A0DYW0|A0DYW0_PARTE Chromosome undetermined scaffold_7, whole... 31 0.55
tr|A0DIT2|A0DIT2_PARTE Chromosome undetermined scaffold_52, whol... 37 0.63
tr|B2WES4|B2WES4_PYRTR Leucine zipper protein 1 OS=Pyrenophora t... 32 0.70
tr|B5W882|B5W882_SPIMA CopG-like DNA-binding OS=Arthrospira maxi... 36 0.82
tr|A8HUA7|A8HUA7_CHLRE Flagellar associated protein OS=Chlamydom... 35 1.4
tr|Q4SWM2|Q4SWM2_TETNG Chromosome undetermined SCAF13607, whole ... 35 1.8
tr|A0BIX7|A0BIX7_PARTE Chromosome undetermined scaffold_11, whol... 31 2.5
tr|B3PM29|B3PM29_MYCA5 Massive surface protein MspI OS=Mycoplasm... 34 3.1
tr|Q23A03|Q23A03_TETTH Putative uncharacterized protein (Fragmen... 34 3.1
tr|B4IBE6|B4IBE6_DROSE GM15350 OS=Drosophila sechellia GN=GM1535... 34 3.1
tr|A2DLB5|A2DLB5_TRIVA DnaJ domain containing protein OS=Trichom... 34 3.1
tr|B1SGT7|B1SGT7_9STRE Putative uncharacterized protein OS=Strep... 34 4.1
tr|B7Q677|B7Q677_IXOSC Girdin, putative OS=Ixodes scapularis GN=... 34 4.1
tr|B4L0R1|B4L0R1_DROMO GI13065 OS=Drosophila mojavensis GN=GI130... 34 4.1
tr|B3NHB7|B3NHB7_DROER GG13818 OS=Drosophila erecta GN=GG13818 P... 34 4.1
tr|A2E053|A2E053_TRIVA Putative uncharacterized protein OS=Trich... 34 4.1
tr|Q8AYJ3|Q8AYJ3_SQUAC BRAP2 OS=Squalus acanthias PE=2 SV=1 33 5.3
tr|B4PGS1|B4PGS1_DROYA GE20113 OS=Drosophila yakuba GN=GE20113 P... 33 5.3
tr|B4HG27|B4HG27_DROSE GM24647 OS=Drosophila sechellia GN=GM2464... 33 5.3
tr|A0EFK8|A0EFK8_PARTE Chromosome undetermined scaffold_93, whol... 33 5.3
tr|Q3IQ02|Q3IQ02_NATPD Homolog 2 to rad50 ATPase OS=Natronomonas... 33 5.3
tr|B4J9C1|B4J9C1_DROGR GH20475 OS=Drosophila grimshawi GN=GH2047... 33 7.0
tr|A2DA80|A2DA80_TRIVA Viral A-type inclusion protein, putative ... 33 7.0
tr|A0CJG2|A0CJG2_PARTE Chromosome undetermined scaffold_2, whole... 33 7.0
tr|Q2B7H2|Q2B7H2_9BACI Flagellar biosynthesis protein B OS=Bacil... 33 9.1
tr|Q9VTY8|Q9VTY8_DROME Sticky OS=Drosophila melanogaster GN=sti ... 33 9.1
tr|Q6NR17|Q6NR17_DROME RE26327p OS=Drosophila melanogaster GN=st... 33 9.1
tr|Q22WA0|Q22WA0_TETTH Putative phospholipid-transporting ATPase... 33 9.1
tr|B6PZX3|B6PZX3_BRAFL Putative uncharacterized protein (Fragmen... 33 9.1

>tr|B4IX74|B4IX74_DROGR GH16845 OS=Drosophila grimshawi GN=GH16845
PE=4 SV=1
Length = 1840

Score = 37.4 bits (85), Expect = 0.37
Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 3/69 (4%)
Frame = -1

Query: 206 EMKAEAEQHQPA-RGRQ--QKEMEELGDLLTKLSNTCKVKDEQLTDVTNELLTTSLSAQK 36
E++ E E++ A G Q Q E+++L D +L C + D QLT+V + L + +K
Sbjct: 1004 ELQEERERNATAGEGNQSLQAELKQLNDNFQRLKYACSITDNQLTEVESMLESEQQRNKK 1063

Query: 35 IQVQLDVAN 9
Q QLD +
Sbjct: 1064 QQTQLDACH 1072


>tr|A0DYW0|A0DYW0_PARTE Chromosome undetermined scaffold_7, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00003195001 PE=4 SV=1
Length = 1003

Score = 30.8 bits (68), Expect(2) = 0.55
Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
Frame = -1

Query: 194 EAEQHQPARGRQQK-EMEELGDLLTKLSNTCKVKDEQLTDVTNELLTTSLSAQKIQVQLD 18
+A+ Q + +Q+ E++ L D L K K K++QLT NEL L QK + Q D
Sbjct: 626 DAKLQQKIKEQQENSEIKRLNDELNKAQQQLKQKEDQLTKAQNEL--NKLKEQKQKEQKD 683



Score = 25.0 bits (53), Expect(2) = 0.55
Identities = 14/68 (20%), Positives = 33/68 (48%)
Frame = -2

Query: 454 KDTHEAANTSQLARQEDWQSNEEVILQVNEYAR*MQDMTERLRSPALSHNTNSKELEMVI 275
KD E + +Q++ Q+N ++ Q+NE + Q + +++ + N +L+ +
Sbjct: 529 KDIQELQENLEKQKQDN-QNNNDLDEQLNESKKQNQKLQDQINNTEQKQNKTQDQLKNQL 587

Query: 274 DALQGELE 251
Q E++
Sbjct: 588 QDAQNEIK 595


>tr|A0DIT2|A0DIT2_PARTE Chromosome undetermined scaffold_52, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00017306001 PE=4 SV=1
Length = 341

Score = 36.6 bits (83), Expect = 0.63
Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
Frame = -1

Query: 206 EMKAEAEQHQPARGRQQ-KEMEELGDLLTKLSNTCKVKDEQLTDVTNELLTTSLSAQKIQ 30
++K E + Q R + Q KE+E KL + K KDEQL D+TN++ QK++
Sbjct: 216 KLKLELQMSQNEREKLQIKEIE-------KLKSIIKEKDEQLIDITNKIQFNVTHYQKLE 268

Query: 29 VQLDVA 12
Q+ VA
Sbjct: 269 EQIQVA 274


>tr|B2WES4|B2WES4_PYRTR Leucine zipper protein 1 OS=Pyrenophora
tritici-repentis (strain Pt-1C-BFP) GN=PTRG_08647 PE=4
SV=1
Length = 1155

Score = 32.0 bits (71), Expect(2) = 0.70
Identities = 25/84 (29%), Positives = 37/84 (44%)
Frame = -1

Query: 254 RRQDDYLITDLQR*V*EMKAEAEQHQPARGRQQKEMEELGDLLTKLSNTCKVKDEQLTDV 75
R +D I LQR V E+ AE Q + + +K +E + LLTK+ K
Sbjct: 411 RLVEDDQIQALQRRVNELHAELSQLRDTHAKSEKRVETMNGLLTKVREQLK--------- 461

Query: 74 TNELLTTSLSAQKIQVQLDVANAS 3
T E S + Q + D+A A+
Sbjct: 462 TTEAKRDSTMVELEQAKKDLAKAN 485



Score = 23.5 bits (49), Expect(2) = 0.70
Identities = 16/70 (22%), Positives = 32/70 (45%)
Frame = -3

Query: 468 LRRSQKTHMRLQTHLNWQDKRIGSQMKRLYCK*TNMQGRCKT*RRDYVHQHLATTQIPKS 289
L + TH RLQ + ++K + S ++ L + + + + DY A ++ +
Sbjct: 334 LNSFKDTHHRLQKDADDREKELNSIIEHLTTRAEKAEEDLRKYKADYKQNETAINELKEK 393

Query: 288 LKW*LTLSKE 259
L+ T +KE
Sbjct: 394 LR---TTAKE 400


>tr|B5W882|B5W882_SPIMA CopG-like DNA-binding OS=Arthrospira maxima
CS-328 GN=AmaxDRAFT_4982 PE=4 SV=1
Length = 533

Score = 36.2 bits (82), Expect = 0.82
Identities = 19/67 (28%), Positives = 41/67 (61%), Gaps = 5/67 (7%)
Frame = -1

Query: 203 MKAEAEQHQPARGRQQKEMEELGDLLTKLSNTCKVKD-----EQLTDVTNELLTTSLSAQ 39
++ E +QH+ + +K+++ +G+L +KL+NT ++D +Q + N+L + +Q
Sbjct: 148 VQQELQQHKDSITDLKKQLKRIGELESKLANTVSLEDHEALKQQNQETLNQLQSQLGDSQ 207

Query: 38 KIQVQLD 18
K+Q QL+
Sbjct: 208 KLQQQLE 214


>tr|A8HUA7|A8HUA7_CHLRE Flagellar associated protein
OS=Chlamydomonas reinhardtii GN=FAP189 PE=4 SV=1
Length = 868

Score = 35.4 bits (80), Expect = 1.4
Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 7/95 (7%)
Frame = -1

Query: 272 RSPRRARRQDDYLITDLQR*V*EMKAEAEQHQPARGRQQKEMEELGDLLTKLSNTCKVKD 93
R+ + Q D I L+ V E KAEAE+ + R +KEM+EL L S+ K K
Sbjct: 187 RTAEADKLQLDMDIQQLKDSVAEKKAEAEREIRKKERMEKEMKELRQQLEIRSSEIKTKQ 246

Query: 92 EQLTDVTNELL-------TTSLSAQKIQVQLDVAN 9
Q+T ++ + + +K+Q + ++ N
Sbjct: 247 LQMTSTEEQVAKLEQMVRDSKAATEKVQKEYNMLN 281


>tr|Q4SWM2|Q4SWM2_TETNG Chromosome undetermined SCAF13607, whole
genome shotgun sequence. (Fragment) OS=Tetraodon
nigroviridis GN=GSTENG00011416001 PE=4 SV=1
Length = 356

Score = 35.0 bits (79), Expect = 1.8
Identities = 21/67 (31%), Positives = 33/67 (49%)
Frame = -1

Query: 206 EMKAEAEQHQPARGRQQKEMEELGDLLTKLSNTCKVKDEQLTDVTNELLTTSLSAQKIQV 27
+++A+ EQH + +E L D L L N C+V+DE L ++ L Q +
Sbjct: 63 DIQAQIEQHSARNHKLCRENAHLTDKLELLVNQCQVRDESLEKISKH---HELQLQLAEA 119

Query: 26 QLDVANA 6
+L ANA
Sbjct: 120 KLQQANA 126


>tr|A0BIX7|A0BIX7_PARTE Chromosome undetermined scaffold_11, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00004867001 PE=4 SV=1
Length = 1014

Score = 31.2 bits (69), Expect(2) = 2.5
Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%)
Frame = -1

Query: 194 EAEQHQPARGRQQK-EMEELGDLLTKLSNTCKVKDEQLTDVTNELLTTSLSAQKIQ 30
+A+ Q + +Q+ E+ L D L K K K++QLT V NEL QK Q
Sbjct: 637 DAKLQQKIKEQQENSEINRLNDELNKAQQQLKQKEDQLTKVQNELNKLKEQKQKEQ 692



Score = 22.3 bits (46), Expect(2) = 2.5
Identities = 10/50 (20%), Positives = 25/50 (50%)
Frame = -2

Query: 400 QSNEEVILQVNEYAR*MQDMTERLRSPALSHNTNSKELEMVIDALQGELE 251
Q+N ++ Q+NE + Q + +++ + N +L+ + Q E++
Sbjct: 557 QNNNDLNKQLNESKKQNQKLQDQINNTEQKQNKTQDQLKNQLQDAQNEIK 606


>tr|B3PM29|B3PM29_MYCA5 Massive surface protein MspI OS=Mycoplasma
arthritidis (strain 158L3-1) GN=mspI PE=4 SV=1
Length = 2416

Score = 34.3 bits (77), Expect = 3.1
Identities = 20/69 (28%), Positives = 34/69 (49%)
Frame = -2

Query: 454 KDTHEAANTSQLARQEDWQSNEEVILQVNEYAR*MQDMTERLRSPALSHNTNSKELEMVI 275
KD H+ N + + D Q+ E++ ++ E + QD+ + + S T +KEL
Sbjct: 948 KDAHKKLNEEKDKLKGDAQNLEKITKKLEEIDQKQQDLADAKKQQEQSEETRAKELAEQA 1007

Query: 274 DALQGELED 248
LQ ELE+
Sbjct: 1008 KKLQTELEN 1016


>tr|Q23A03|Q23A03_TETTH Putative uncharacterized protein (Fragment)
OS=Tetrahymena thermophila SB210 GN=TTHERM_00885730 PE=4
SV=2
Length = 544

Score = 34.3 bits (77), Expect = 3.1
Identities = 18/46 (39%), Positives = 21/46 (45%)
Frame = +3

Query: 348 CIYLAYSFTCSITSSFDCQSSCLAS*DVFAASCVSFGYVVAVVSSC 485
CIY TC+I SS C CVSF Y ++V SSC
Sbjct: 387 CIYTPEQGTCTIKSSLGCSQKS-------RMDCVSFPYCISVFSSC 425