BP919049
Clone id YMU001_000120_F01
Library
Length 486
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000120_F01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AAAGAGGACCTCAGAAATCTCCAAAAATCGTAGGCATAGGACTATAACTATGGCATTAAT
GACGTCACAACAAGATCTCCAAGCATTTGCTGCAAGGGGTATGGCATGGTGGTATTTTAA
CAAGGACCAGTGATGCTGCCAGGGTGTTGCAAGAGGTATTGCGAGGTCAGCATGACGATG
AGATTGAAGATGAACTATTACAACAAGAACTGCCCACAGGAGGCTGGTGGTCTGCTTTGC
TGAGAGCTCTGCAAGGTATTGTGGCATTGGGGAATGATGCTAAAGCTAGACTTCAAACAA
GAGACAACTTGGAAAATCGAGATTTTTATTGAGGGTCAAGTTATTGTCAATAATAATAGC
TCCACTAGGTAGATTTGAGACACATGTAGAGTCCATGAGGCTATCCAAATGTTGCAAGTT
TTAGTGTGTCAATGTGCATGCCTCAACTCGACTCTTATGTGTGACTTTTGGACTCGGTAC
AATCTG
■■Homology search results ■■ -
sp_hit_id Q42093
Definition sp|Q42093|MRP2_ARATH Multidrug resistance-associated protein 2 OS=Arabidopsis thaliana
Align length 72
Score (bit) 37.0
E-value 0.047
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919049|Adiantum capillus-veneris mRNA, clone:
YMU001_000120_F01.
(486 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q42093|MRP2_ARATH Multidrug resistance-associated protein 2 O... 37 0.047
sp|Q9C8G9|MRP1_ARATH Multidrug resistance-associated protein 1 O... 37 0.061
sp|P40987|CIN1_YEAST Chromosome instability protein 1 OS=Sacchar... 30 7.6
sp|Q12307|YD162_YEAST Putative uncharacterized protein YDL162C O... 29 9.9
sp|Q99678|GPR20_HUMAN Probable G-protein coupled receptor 20 OS=... 29 9.9

>sp|Q42093|MRP2_ARATH Multidrug resistance-associated protein 2
OS=Arabidopsis thaliana GN=MRP2 PE=1 SV=2
Length = 1623

Score = 37.0 bits (84), Expect = 0.047
Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 1/72 (1%)
Frame = +3

Query: 114 ILTRTSDAARVLQEVLRGXXXXXXXXXXXXXXXPTGGWWSALLRALQGIVALGNDAKARL 293
IL RT+DA L+ VL G GW S+L R ++G+ + A+ R+
Sbjct: 1545 ILKRTNDAVVTLRSVLEGKHDKEIAESLEEHNISREGWLSSLYRMVEGLAVMSRLARNRM 1604

Query: 294 QTRD-NLENRDF 326
Q D N E F
Sbjct: 1605 QQPDYNFEGNTF 1616


>sp|Q9C8G9|MRP1_ARATH Multidrug resistance-associated protein 1
OS=Arabidopsis thaliana GN=MRP1 PE=1 SV=1
Length = 1622

Score = 36.6 bits (83), Expect = 0.061
Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 1/72 (1%)
Frame = +3

Query: 114 ILTRTSDAARVLQEVLRGXXXXXXXXXXXXXXXPTGGWWSALLRALQGIVALGNDAKARL 293
IL +T DA L+ VL G WW +L + ++G+ + A+ R+
Sbjct: 1544 ILKKTKDAVVTLRSVLEGKHDKEIEDSLNQSDISRERWWPSLYKMVEGLAVMSRLARNRM 1603

Query: 294 QTRD-NLENRDF 326
Q D NLE + F
Sbjct: 1604 QHPDYNLEGKSF 1615


>sp|P40987|CIN1_YEAST Chromosome instability protein 1
OS=Saccharomyces cerevisiae GN=CIN1 PE=1 SV=1
Length = 1014

Score = 29.6 bits (65), Expect = 7.6
Identities = 18/66 (27%), Positives = 29/66 (43%)
Frame = +1

Query: 256 VLWHWGMMLKLDFKQETTWKIEIFIEGQVIVNNNSSTR*I*DTCRVHEAIQMLQVLVCQC 435
+L +W + + DF QE WK + Q +N +E I ++Q ++ QC
Sbjct: 579 ILKYWQLTGQNDFNQELFWKFVDIVSPQKKLN------------LYNEFIPIIQQIISQC 626

Query: 436 ACLNST 453
LN T
Sbjct: 627 VSLNYT 632


>sp|Q12307|YD162_YEAST Putative uncharacterized protein YDL162C
OS=Saccharomyces cerevisiae GN=YDL162C PE=5 SV=1
Length = 118

Score = 29.3 bits (64), Expect = 9.9
Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 12/81 (14%)
Frame = -1

Query: 207 LVVIVHLQSHRHADLAIPLATPWQHHWSLLKY---HHAIPL---------AANAWRSCCD 64
L+ ++ H + D ++ +AT +H S +KY H A P + W CC
Sbjct: 27 LLFVIERNFHHYPDDSLYVATISDNHTSKIKYFEQHKAPPTFRKTCNRNSYCSRWFYCCL 86

Query: 63 VINAIVIVLCLRFLEISEVLF 1
+++ + C+ LE+++ +F
Sbjct: 87 TLSSFCSLRCVPPLEMADGIF 107


>sp|Q99678|GPR20_HUMAN Probable G-protein coupled receptor 20
OS=Homo sapiens GN=GPR20 PE=2 SV=1
Length = 358

Score = 29.3 bits (64), Expect = 9.9
Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
Frame = -1

Query: 222 LLWAVLVVIVHLQSHRHA-DLAIPLATPWQHHWSLLKYHHAIPLAANAWRSCCDVI 58
LL VL++ + + HA +A+ L HH SL+ YH A+ L ++ SC D I
Sbjct: 242 LLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTL--SSLNSCMDPI 295


tr_hit_id A7Q1B7
Definition tr|A7Q1B7|A7Q1B7_VITVI Chromosome chr10 scaffold_43, whole genome shotgun sequence OS=Vitis vinifera
Align length 69
Score (bit) 45.1
E-value 0.002
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919049|Adiantum capillus-veneris mRNA, clone:
YMU001_000120_F01.
(486 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7Q1B7|A7Q1B7_VITVI Chromosome chr10 scaffold_43, whole genom... 45 0.002
tr|A9TGR0|A9TGR0_PHYPA ATP-binding cassette transporter, subfami... 44 0.005
tr|A9TWW4|A9TWW4_PHYPA ATP-binding cassette transporter, subfami... 40 0.044
tr|Q8GU51|Q8GU51_ORYSJ MRP-like ABC transporter (Fragment) OS=Or... 40 0.057
tr|Q7XTT6|Q7XTT6_ORYSJ OSJNBa0058K23.17 protein OS=Oryza sativa ... 40 0.057
tr|Q0JA19|Q0JA19_ORYSJ Os04g0620000 protein OS=Oryza sativa subs... 40 0.057
tr|Q01JU7|Q01JU7_ORYSA H0714H04.5 protein OS=Oryza sativa GN=H07... 40 0.057
tr|A3AXH7|A3AXH7_ORYSJ Putative uncharacterized protein OS=Oryza... 40 0.057
tr|A2XXN8|A2XXN8_ORYSI Putative uncharacterized protein OS=Oryza... 40 0.057
tr|A7Q1C1|A7Q1C1_VITVI Chromosome chr10 scaffold_43, whole genom... 38 0.28
tr|Q0WLP4|Q0WLP4_ARATH MRP-like ABC transporter (Fragment) OS=Ar... 37 0.48
tr|B7FNG1|B7FNG1_MEDTR Putative uncharacterized protein OS=Medic... 35 1.8
tr|B1Q479|B1Q479_CAPCH Putative multidrug resistance-associated ... 34 3.1
tr|A9TJV3|A9TJV3_PHYPA Predicted protein OS=Physcomitrella paten... 34 4.1
tr|Q8WQL9|Q8WQL9_LEUMA Male-specific beta-glycosidase OS=Leucoph... 33 5.5
tr|B8G3U2|B8G3U2_9CHLR Putative uncharacterized protein OS=Chlor... 33 7.2

>tr|A7Q1B7|A7Q1B7_VITVI Chromosome chr10 scaffold_43, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00028389001
PE=3 SV=1
Length = 1135

Score = 45.1 bits (105), Expect = 0.002
Identities = 23/69 (33%), Positives = 33/69 (47%)
Frame = +3

Query: 114 ILTRTSDAARVLQEVLRGXXXXXXXXXXXXXXXPTGGWWSALLRALQGIVALGNDAKARL 293
IL +T DA LQ VL G GWWS+L R ++G+ + A+ RL
Sbjct: 1058 ILKKTKDAVITLQGVLEGKHDKVIEETLNQYQVSRDGWWSSLYRMIEGLAVMSRLARNRL 1117

Query: 294 QTRDNLENR 320
Q+ + E+R
Sbjct: 1118 QSENGFEDR 1126


>tr|A9TGR0|A9TGR0_PHYPA ATP-binding cassette transporter, subfamily C,
member 11, group MRP protein PpABCC11 OS=Physcomitrella
patens subsp. patens GN=ppabcc11 PE=3 SV=1
Length = 1630

Score = 43.5 bits (101), Expect = 0.005
Identities = 24/71 (33%), Positives = 32/71 (45%)
Frame = +3

Query: 114 ILTRTSDAARVLQEVLRGXXXXXXXXXXXXXXXPTGGWWSALLRALQGIVALGNDAKARL 293
IL T DA R L +VL G GWWSAL R L+G +G +A+ R+
Sbjct: 1549 ILEVTRDATRTLHQVLVGQHDTSIREALLQRQATEEGWWSALTRVLEGFALMGREARNRI 1608

Query: 294 QTRDNLENRDF 326
+ E D+
Sbjct: 1609 SHNQDREAFDW 1619


>tr|A9TWW4|A9TWW4_PHYPA ATP-binding cassette transporter, subfamily C,
member 3, group MRP protein PpABCC3 OS=Physcomitrella
patens subsp. patens GN=ppabcc3 PE=3 SV=1
Length = 1622

Score = 40.4 bits (93), Expect = 0.044
Identities = 22/71 (30%), Positives = 30/71 (42%)
Frame = +3

Query: 114 ILTRTSDAARVLQEVLRGXXXXXXXXXXXXXXXPTGGWWSALLRALQGIVALGNDAKARL 293
IL T DA R L +VL G WWSAL R L+G +G + + R+
Sbjct: 1541 ILEATRDATRTLHQVLLGHHDTSIRETLLQRQATEESWWSALTRVLEGFAVMGREGRNRI 1600

Query: 294 QTRDNLENRDF 326
+ E D+
Sbjct: 1601 SHDQDREPIDW 1611


>tr|Q8GU51|Q8GU51_ORYSJ MRP-like ABC transporter (Fragment) OS=Oryza
sativa subsp. japonica GN=mrp1 PE=3 SV=1
Length = 1627

Score = 40.0 bits (92), Expect = 0.057
Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
Frame = +3

Query: 90 LQGVWHGGILTRTSDAARVLQEVLRGXXXXXXXXXXXXXXXPTGGWWSALLRALQGIVAL 269
L+ IL +T DA LQ VL G P+ WWS+L + ++G+ +
Sbjct: 1543 LEAAEGNNILRKTKDAVITLQNVLEGKHNTEIDDTLAQYEVPSDRWWSSLYKVMEGLAMM 1602

Query: 270 GNDAKARLQTRD-NLEN 317
+ RLQ N EN
Sbjct: 1603 SRLGRNRLQQPSYNFEN 1619


>tr|Q7XTT6|Q7XTT6_ORYSJ OSJNBa0058K23.17 protein OS=Oryza sativa
subsp. japonica GN=OSJNBa0058K23.17 PE=3 SV=2
Length = 1628

Score = 40.0 bits (92), Expect = 0.057
Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
Frame = +3

Query: 90 LQGVWHGGILTRTSDAARVLQEVLRGXXXXXXXXXXXXXXXPTGGWWSALLRALQGIVAL 269
L+ IL +T DA LQ VL G P+ WWS+L + ++G+ +
Sbjct: 1543 LEAAEGNNILRKTKDAVITLQNVLEGKHNTEIDDTLAQYEVPSDRWWSSLYKVMEGLAMM 1602

Query: 270 GNDAKARLQTRD-NLEN 317
+ RLQ N EN
Sbjct: 1603 SRLGRNRLQQPSYNFEN 1619


>tr|Q0JA19|Q0JA19_ORYSJ Os04g0620000 protein OS=Oryza sativa subsp.
japonica GN=Os04g0620000 PE=3 SV=1
Length = 1650

Score = 40.0 bits (92), Expect = 0.057
Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
Frame = +3

Query: 90 LQGVWHGGILTRTSDAARVLQEVLRGXXXXXXXXXXXXXXXPTGGWWSALLRALQGIVAL 269
L+ IL +T DA LQ VL G P+ WWS+L + ++G+ +
Sbjct: 1565 LEAAEGNNILRKTKDAVITLQNVLEGKHNTEIDDTLAQYEVPSDRWWSSLYKVMEGLAMM 1624

Query: 270 GNDAKARLQTRD-NLEN 317
+ RLQ N EN
Sbjct: 1625 SRLGRNRLQQPSYNFEN 1641


>tr|Q01JU7|Q01JU7_ORYSA H0714H04.5 protein OS=Oryza sativa
GN=H0714H04.5 PE=3 SV=1
Length = 1628

Score = 40.0 bits (92), Expect = 0.057
Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
Frame = +3

Query: 90 LQGVWHGGILTRTSDAARVLQEVLRGXXXXXXXXXXXXXXXPTGGWWSALLRALQGIVAL 269
L+ IL +T DA LQ VL G P+ WWS+L + ++G+ +
Sbjct: 1543 LEAAEGNNILRKTKDAVITLQNVLEGKHNTEIDDTLAQYEVPSDRWWSSLYKVMEGLAMM 1602

Query: 270 GNDAKARLQTRD-NLEN 317
+ RLQ N EN
Sbjct: 1603 SRLGRNRLQQPSYNFEN 1619


>tr|A3AXH7|A3AXH7_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_015499 PE=3 SV=1
Length = 1463

Score = 40.0 bits (92), Expect = 0.057
Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
Frame = +3

Query: 90 LQGVWHGGILTRTSDAARVLQEVLRGXXXXXXXXXXXXXXXPTGGWWSALLRALQGIVAL 269
L+ IL +T DA LQ VL G P+ WWS+L + ++G+ +
Sbjct: 1378 LEAAEGNNILRKTKDAVITLQNVLEGKHNTEIDDTLAQYEVPSDRWWSSLYKVMEGLAMM 1437

Query: 270 GNDAKARLQTRD-NLEN 317
+ RLQ N EN
Sbjct: 1438 SRLGRNRLQQPSYNFEN 1454


>tr|A2XXN8|A2XXN8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_17449 PE=3 SV=1
Length = 1650

Score = 40.0 bits (92), Expect = 0.057
Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
Frame = +3

Query: 90 LQGVWHGGILTRTSDAARVLQEVLRGXXXXXXXXXXXXXXXPTGGWWSALLRALQGIVAL 269
L+ IL +T DA LQ VL G P+ WWS+L + ++G+ +
Sbjct: 1565 LEAAEGNNILRKTKDAVITLQNVLEGKHNTEIDDTLAQYEVPSDRWWSSLYKVMEGLAMM 1624

Query: 270 GNDAKARLQTRD-NLEN 317
+ RLQ N EN
Sbjct: 1625 SRLGRNRLQQPSYNFEN 1641


>tr|A7Q1C1|A7Q1C1_VITVI Chromosome chr10 scaffold_43, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00028393001
PE=3 SV=1
Length = 1193

Score = 37.7 bits (86), Expect = 0.28
Identities = 19/65 (29%), Positives = 30/65 (46%)
Frame = +3

Query: 114 ILTRTSDAARVLQEVLRGXXXXXXXXXXXXXXXPTGGWWSALLRALQGIVALGNDAKARL 293
IL +T+DA L+ VL G P WWSAL + ++G+ + A+ R
Sbjct: 1115 ILKKTNDAVLTLRGVLEGTHDEVIEEMLKEYQVPRDRWWSALYKMVEGLAVMNRLARHRF 1174

Query: 294 QTRDN 308
Q ++
Sbjct: 1175 QQSEH 1179