BP919051 [AcEST]

BP919051
Clone id	YMU001_000120_F04
Library	YMU01
Length	405
Definition	Adiantum capillus-veneris mRNA. clone: YMU001_000120_F04.
Accession	BP919051
Tissue type	prothallium
Developmental stage	-
Contig ID	-
Sequence	CAGAAACTTTCTTCAGTAGACACTGACTCTGTGTACTCATGCATCATACTCGACCAATCT AGCACTTCTACAAAGACATCAACCATTGATAATCATATTTTTGTCAAGGGTCTCAGATAT AAATCCTGATCATTATAATCATTTAGCAATCACATCCGCACAACACTGATCTTTTTATGG ATGTCCTTGATCTACTAAATCTGGTTACTATCAGATTCATATCTTTTCATTTCACATTTC AATCAAGCAAACCATGCGCATGACCATCCCCTCAGGACAGTACATCCACATAGCATGCAA TTCACAAATGACACACTGAGTTCACACTGAAAATCACATTCACATCACTACGTCCGTGGA TGAAAATCATGATCAATCGGTAACATATTTAGCAATCACATCTAG
■■Homology search results ■■	-
Swiss-Prot (release 56.9)	Link to BlastX Result : Swiss-Prot
sp_hit_id	Q03302
Definition	sp\|Q03302\|SODM_HALMA Superoxide dismutase [Mn] OS=Haloarcula marismortui
Align length	22
Score (bit)	28.9
E-value	8.2
Report	BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BP919051\|Adiantum capillus-veneris mRNA, clone: YMU001_000120_F04. (405 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp\|Q03302\|SODM_HALMA Superoxide dismutase [Mn] OS=Haloarcula mar... 29 8.2 sp\|Q8VII0\|FRMD6_RAT FERM domain-containing protein 6 (Fragment) ... 29 8.2 sp\|Q8C0V9\|FRMD6_MOUSE FERM domain-containing protein 6 OS=Mus mu... 29 8.2 >sp\|Q03302\|SODM_HALMA Superoxide dismutase [Mn] OS=Haloarcula marismortui GN=sod PE=3 SV=2 Length = 203 Score = 28.9 bits (63), Expect = 8.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 83 VDVFVEVLDWSSMMHEYTESVS 18 +D F EV+DW EY +SVS Sbjct: 179 IDAFFEVVDWDKAAEEYEKSVS 200 >sp\|Q8VII0\|FRMD6_RAT FERM domain-containing protein 6 (Fragment) OS=Rattus norvegicus GN=Frmd6 PE=2 SV=2 Length = 327 Score = 28.9 bits (63), Expect = 8.2 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -3 Query: 379 RLIMIFIHGRSDVNVIFSVNSVCHLIACYVDVLSGDGHAHGL 248 R + IF+ V++I +V +CH + D+L D H GL Sbjct: 16 RRVCIFLPNDKSVSIIINVKILCHQLLVQVCDLLRLKDSHLFGL 59 >sp\|Q8C0V9\|FRMD6_MOUSE FERM domain-containing protein 6 OS=Mus musculus GN=Frmd6 PE=1 SV=2 Length = 622 Score = 28.9 bits (63), Expect = 8.2 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -3 Query: 379 RLIMIFIHGRSDVNVIFSVNSVCHLIACYVDVLSGDGHAHGL 248 R + IF+ V++I +V +CH + D+L D H GL Sbjct: 16 RRVCIFLPNDKSVSIIINVKILCHQLLVQVCDLLRLKDSHLFGL 59
TrEMBL (release 39.9)	Link to BlastX Result : TrEMBL
tr_hit_id	B7GEC4
Definition	tr\|B7GEC4\|B7GEC4_PHATR Predicted protein OS=Phaeodactylum tricornutum CCAP 1055/1
Align length	46
Score (bit)	33.1
E-value	7.2
Report	BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BP919051\|Adiantum capillus-veneris mRNA, clone: YMU001_000120_F04. (405 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tr\|B7GEC4\|B7GEC4_PHATR Predicted protein OS=Phaeodactylum tricor... 33 7.2 >tr\|B7GEC4\|B7GEC4_PHATR Predicted protein OS=Phaeodactylum tricornutum CCAP 1055/1 GN=PHATRDRAFT_50515 PE=4 SV=1 Length = 1010 Score = 33.1 bits (74), Expect = 7.2 Identities = 18/46 (39%), Positives = 26/46 (56%) Frame = +1 Query: 154 IRTTLIFLWMSLIY*IWLLSDSYLFISHFNQANHAHDHPLRTVHPH 291 IR TL+ L+Y +WL +D F++ ANH H H + +HPH Sbjct: 77 IRRTLL-----LVYCLWLSADCRAFVAGPPGANHPHPH--QRLHPH 115