BP919053
Clone id YMU001_000120_F07
Library
Length 441
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000120_F07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AATATCATGGTAAATATATCGAGTAGCGACTCTGCGCGTAAGGTGTGATGGTGCATGCAC
TTGCGAGGACCAGTCTTTCATTGTGCATACAGTGCCTTCTTTAACATGCTCATTAAAGAA
GCCTCGTGGAAGGCAACACAGACTTTTGTTACATCCTTCCTTTGACATTATCGAGAAACG
CAATCGTCAAGAAGAGTGTTACCTAGTAACTGTCCACCCACTTCATCAGAAAACATAGAA
ACCACTCCATCATCAGCATCAGGCCACCAAGATTTTCCTGAGCGGTTTGGCGACATCATA
TGAACTCCCTCTTGGTTCTCCTGTCTGTGATCAGCTGCATATATGTTGCTAAAAGAAACA
TAAGTTGAAGCTTCCTTCAAATCTAATTGATCTGCATGTTTAAATGCCCACATTGCAAGT
TTTGCATCTCTCAAACGGTGA
■■Homology search results ■■ -
sp_hit_id Q9MA50
Definition sp|Q9MA50|PPR13_ARATH Pentatricopeptide repeat-containing protein At1g05750, chloroplastic OS=Arabidopsis thaliana
Align length 34
Score (bit) 31.6
E-value 1.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919053|Adiantum capillus-veneris mRNA, clone:
YMU001_000120_F07.
(441 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9MA50|PPR13_ARATH Pentatricopeptide repeat-containing protei... 32 1.5
sp|Q9SI53|PP147_ARATH Pentatricopeptide repeat-containing protei... 32 1.5
sp|Q1WK23|PRS23_MACMU Serine protease 23 OS=Macaca mulatta GN=PR... 30 3.4
sp|O95084|PRS23_HUMAN Serine protease 23 OS=Homo sapiens GN=PRSS... 30 3.4
sp|Q6AY61|PRS23_RAT Serine protease 23 OS=Rattus norvegicus GN=P... 30 5.7
sp|O51173|FLID_BORBU Flagellar hook-associated protein 2 OS=Borr... 30 5.7
sp|Q5TG08|YV009_HUMAN Putative uncharacterized protein LOC388900... 30 5.9
sp|O80488|PPR23_ARATH Pentatricopeptide repeat-containing protei... 29 7.5
sp|Q9P2D8|K1409_HUMAN Uncharacterized protein KIAA1409 OS=Homo s... 29 10.0
sp|P24473|GSTK1_RAT Glutathione S-transferase kappa 1 OS=Rattus ... 29 10.0

>sp|Q9MA50|PPR13_ARATH Pentatricopeptide repeat-containing protein
At1g05750, chloroplastic OS=Arabidopsis thaliana
GN=PDE247 PE=2 SV=1
Length = 500

Score = 31.6 bits (70), Expect = 1.5
Identities = 16/34 (47%), Positives = 20/34 (58%)
Frame = -2

Query: 419 LAMWAFKHADQLDLKEASTYVSFSNIYAADHRQE 318
LA KH L++K S YV SN+YAAD + E
Sbjct: 394 LAERLMKHLTDLNVKSHSNYVILSNMYAADGKWE 427


>sp|Q9SI53|PP147_ARATH Pentatricopeptide repeat-containing protein
At2g03880, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H44 PE=2 SV=1
Length = 630

Score = 31.6 bits (70), Expect = 1.5
Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 5/60 (8%)
Frame = -2

Query: 431 RDAKLAMWAFKHADQLDLKEASTYVSFSNIYAADHRQENQEGVHMMSPNRS-----GKSW 267
R+ LA +A K LD ++A TY SNIYA + ++ E + +R G SW
Sbjct: 441 RNMVLAEYAAKKVIALDPEDAGTYTLLSNIYANSQKWDSVEEIRTRMRDRGIKKEPGCSW 500


>sp|Q1WK23|PRS23_MACMU Serine protease 23 OS=Macaca mulatta
GN=PRSS23 PE=2 SV=1
Length = 383

Score = 30.4 bits (67), Expect = 3.4
Identities = 12/34 (35%), Positives = 21/34 (61%)
Frame = -2

Query: 377 KEASTYVSFSNIYAADHRQENQEGVHMMSPNRSG 276
+EA Y+S+ +YA R E Q G++++S + G
Sbjct: 79 EEAKQYLSYETLYANGSRTETQVGIYILSSSGGG 112


>sp|O95084|PRS23_HUMAN Serine protease 23 OS=Homo sapiens GN=PRSS23
PE=1 SV=1
Length = 383

Score = 30.4 bits (67), Expect = 3.4
Identities = 12/34 (35%), Positives = 21/34 (61%)
Frame = -2

Query: 377 KEASTYVSFSNIYAADHRQENQEGVHMMSPNRSG 276
+EA Y+S+ +YA R E Q G++++S + G
Sbjct: 79 EEAKQYLSYETLYANGSRTETQVGIYILSSSGDG 112


>sp|Q6AY61|PRS23_RAT Serine protease 23 OS=Rattus norvegicus
GN=Prss23 PE=2 SV=1
Length = 383

Score = 29.6 bits (65), Expect = 5.7
Identities = 14/42 (33%), Positives = 26/42 (61%)
Frame = -2

Query: 377 KEASTYVSFSNIYAADHRQENQEGVHMMSPNRSGKSWWPDAD 252
+EA Y+S+ +YA R E Q G++++S N G++ D++
Sbjct: 79 EEAKQYLSYETLYANGSRTETQVGIYILS-NGEGRARSRDSE 119


>sp|O51173|FLID_BORBU Flagellar hook-associated protein 2
OS=Borrelia burgdorferi GN=fliD PE=3 SV=1
Length = 665

Score = 29.6 bits (65), Expect = 5.7
Identities = 14/48 (29%), Positives = 25/48 (52%)
Frame = +2

Query: 35 RVRCDGACTCEDQSFIVHTVPSLTCSLKKPRGRQHRLLLHPSFDIIEK 178
+++ DG D + I VP++T SLKKP + P ++ I++
Sbjct: 395 KIKFDGVDVERDSNVINDLVPNVTLSLKKPSSDMVEAKIEPDYEGIKR 442


>sp|Q5TG08|YV009_HUMAN Putative uncharacterized protein LOC388900
OS=Homo sapiens PE=1 SV=2
Length = 646

Score = 29.6 bits (65), Expect = 5.9
Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%)
Frame = -1

Query: 174 SIMSKEGCNKSLCCLPRGFFNEHVKEGTVC-TMKDWSSQVHAPS 46
S++SK CC P+ +F+ H + +C TM W S PS
Sbjct: 240 SLLSKAVYTSFCCCFPQSWFDTHEFKSDICNTMSLWISGGTYPS 283


>sp|O80488|PPR23_ARATH Pentatricopeptide repeat-containing protein
At1g09190 OS=Arabidopsis thaliana GN=PCMP-E70 PE=2 SV=1
Length = 484

Score = 29.3 bits (64), Expect = 7.5
Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%)
Frame = -2

Query: 428 DAKLAMWAFKHADQLDLKEASTYVSFSNIYAADHRQENQEGVH-MMSPNRSGKS 270
D KLA A +++ + YV SN+YA + R ++ E V +M NR KS
Sbjct: 420 DVKLAEVAAMELVKIEPGNSGNYVLLSNLYAEEGRWQDVEKVRTLMKKNRLRKS 473


>sp|Q9P2D8|K1409_HUMAN Uncharacterized protein KIAA1409 OS=Homo
sapiens GN=KIAA1409 PE=2 SV=3
Length = 2635

Score = 28.9 bits (63), Expect = 10.0
Identities = 13/31 (41%), Positives = 17/31 (54%)
Frame = -1

Query: 162 KEGCNKSLCCLPRGFFNEHVKEGTVCTMKDW 70
KEG N+ LC +P N+ V E C M +W
Sbjct: 601 KEGLNRILCLIPYNVINQSVWE---CIMPEW 628


>sp|P24473|GSTK1_RAT Glutathione S-transferase kappa 1 OS=Rattus
norvegicus GN=Gstk1 PE=1 SV=3
Length = 226

Score = 28.9 bits (63), Expect = 10.0
Identities = 11/19 (57%), Positives = 15/19 (78%)
Frame = -1

Query: 132 LPRGFFNEHVKEGTVCTMK 76
+P+ FF EHVK+GTV M+
Sbjct: 83 VPKDFFGEHVKKGTVNAMR 101


tr_hit_id B4F8N7
Definition tr|B4F8N7|B4F8N7_MAIZE Putative uncharacterized protein OS=Zea mays
Align length 87
Score (bit) 40.8
E-value 0.034
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919053|Adiantum capillus-veneris mRNA, clone:
YMU001_000120_F07.
(441 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4F8N7|B4F8N7_MAIZE Putative uncharacterized protein OS=Zea m... 41 0.034
tr|Q6H4W1|Q6H4W1_ORYSJ Putative pentatricopeptide (PPR) repeat-c... 40 0.075
tr|Q0E3L9|Q0E3L9_ORYSJ Os02g0167200 protein (Fragment) OS=Oryza ... 40 0.075
tr|B8AIK6|B8AIK6_ORYSI Putative uncharacterized protein OS=Oryza... 40 0.075
tr|A3A3I4|A3A3I4_ORYSJ Putative uncharacterized protein OS=Oryza... 40 0.075
tr|A7P8S8|A7P8S8_VITVI Chromosome chr3 scaffold_8, whole genome ... 36 0.83
tr|A9U4W7|A9U4W7_PHYPA Predicted protein OS=Physcomitrella paten... 34 3.2
tr|A7PA26|A7PA26_VITVI Chromosome chr14 scaffold_9, whole genome... 34 3.2
tr|Q0CGG3|Q0CGG3_ASPTN Putative uncharacterized protein OS=Asper... 34 4.1
tr|Q2QNV4|Q2QNV4_ORYSJ Pentatricopeptide, putative, expressed OS... 33 7.0
tr|Q0IMR5|Q0IMR5_ORYSJ Os12g0552300 protein OS=Oryza sativa subs... 33 7.0
tr|A3CIA3|A3CIA3_ORYSJ Putative uncharacterized protein OS=Oryza... 33 7.0
tr|Q4V8A5|Q4V8A5_RAT Hypothetical LOC300074 OS=Rattus norvegicus... 33 9.2
tr|A7Q9C2|A7Q9C2_VITVI Chromosome chr19 scaffold_66, whole genom... 33 9.2
tr|A5APN9|A5APN9_VITVI Putative uncharacterized protein OS=Vitis... 33 9.2
tr|A2E1N6|A2E1N6_TRIVA Dedicator of cytokinesis family protein O... 33 9.2

>tr|B4F8N7|B4F8N7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 706

Score = 40.8 bits (94), Expect = 0.034
Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 5/87 (5%)
Frame = -2

Query: 428 DAKLAMWAFKHADQLDLKEASTYVSFSNIYAADHRQENQEGVHMMSPNRS-----GKSWW 264
+A+L ++ KH +LD K S YV SNIYA R + V + +R G SW
Sbjct: 602 NAELGEFSAKHLFRLDPKNPSPYVLLSNIYATLGRHGDASAVRALMSSRGVVKGRGYSWV 661

Query: 263 PDADDGVVSMFSDEVGGQLLGNTLLDD 183
D M +D++G + T+ D
Sbjct: 662 NHKDGSRAFMVADDLGTDVGERTMFSD 688


>tr|Q6H4W1|Q6H4W1_ORYSJ Putative pentatricopeptide (PPR)
repeat-containing protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0085K21.32 PE=4 SV=1
Length = 803

Score = 39.7 bits (91), Expect = 0.075
Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 5/76 (6%)
Frame = -2

Query: 428 DAKLAMWAFKHADQLDLKEASTYVSFSNIYAADHRQENQEGVHMMSPNR---SGKSW-WP 261
+A+L A +H ++D K S YV SNIYA+ R + V + NR G+ + W
Sbjct: 702 NAELGKCAAEHLFRIDPKNPSPYVLLSNIYASLGRHGDASAVRALMSNRGVVKGRGYSWI 761

Query: 260 DADDGV-VSMFSDEVG 216
D DGV M +D++G
Sbjct: 762 DQKDGVRAFMVADDLG 777


>tr|Q0E3L9|Q0E3L9_ORYSJ Os02g0167200 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os02g0167200 PE=4 SV=1
Length = 526

Score = 39.7 bits (91), Expect = 0.075
Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 5/76 (6%)
Frame = -2

Query: 428 DAKLAMWAFKHADQLDLKEASTYVSFSNIYAADHRQENQEGVHMMSPNR---SGKSW-WP 261
+A+L A +H ++D K S YV SNIYA+ R + V + NR G+ + W
Sbjct: 425 NAELGKCAAEHLFRIDPKNPSPYVLLSNIYASLGRHGDASAVRALMSNRGVVKGRGYSWI 484

Query: 260 DADDGV-VSMFSDEVG 216
D DGV M +D++G
Sbjct: 485 DQKDGVRAFMVADDLG 500


>tr|B8AIK6|B8AIK6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_05996 PE=4 SV=1
Length = 803

Score = 39.7 bits (91), Expect = 0.075
Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 5/76 (6%)
Frame = -2

Query: 428 DAKLAMWAFKHADQLDLKEASTYVSFSNIYAADHRQENQEGVHMMSPNR---SGKSW-WP 261
+A+L A +H ++D K S YV SNIYA+ R + V + NR G+ + W
Sbjct: 702 NAELGKCAAEHLFRIDPKNPSPYVLLSNIYASLGRHGDASAVRALMSNRGVVKGRGYSWI 761

Query: 260 DADDGV-VSMFSDEVG 216
D DGV M +D++G
Sbjct: 762 DQKDGVRAFMVADDLG 777


>tr|A3A3I4|A3A3I4_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_005356 PE=4 SV=1
Length = 785

Score = 39.7 bits (91), Expect = 0.075
Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 5/76 (6%)
Frame = -2

Query: 428 DAKLAMWAFKHADQLDLKEASTYVSFSNIYAADHRQENQEGVHMMSPNR---SGKSW-WP 261
+A+L A +H ++D K S YV SNIYA+ R + V + NR G+ + W
Sbjct: 676 NAELGKCAAEHLFRIDPKNPSPYVLLSNIYASLGRHGDASAVRALMSNRGVVKGRGYSWI 735

Query: 260 DADDGV-VSMFSDEVG 216
D DGV M +D++G
Sbjct: 736 DQKDGVRAFMVADDLG 751


>tr|A7P8S8|A7P8S8_VITVI Chromosome chr3 scaffold_8, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00036292001
PE=4 SV=1
Length = 623

Score = 36.2 bits (82), Expect = 0.83
Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 5/60 (8%)
Frame = -2

Query: 431 RDAKLAMWAFKHADQLDLKEASTYVSFSNIYAADHRQENQEGVHMMSPNRS-----GKSW 267
R+ LA++A K +L+ ++A TY+ SNIYA R E+ V NR G SW
Sbjct: 434 RNVDLAIYAAKKIIELEPEDAGTYILLSNIYANTQRWEDVAEVRKTMTNRGIRKTPGCSW 493


>tr|A9U4W7|A9U4W7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_156474 PE=4 SV=1
Length = 908

Score = 34.3 bits (77), Expect = 3.2
Identities = 23/57 (40%), Positives = 29/57 (50%), Gaps = 5/57 (8%)
Frame = -2

Query: 422 KLAMWAFKHADQLDLKEASTYVSFSNIYAADHRQENQEGVHMMSPNRS-----GKSW 267
++A +A K +L K ASTYV SNIYAA E + V M R G+SW
Sbjct: 722 EMAEFAAKERLKLKPKSASTYVLLSNIYAATGNWEQKLLVRSMMQRRGIRKEPGRSW 778


>tr|A7PA26|A7PA26_VITVI Chromosome chr14 scaffold_9, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00037946001
PE=4 SV=1
Length = 820

Score = 34.3 bits (77), Expect = 3.2
Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 4/49 (8%)
Frame = -2

Query: 407 AFKHADQL----DLKEASTYVSFSNIYAADHRQENQEGVHMMSPNRSGK 273
A + ADQL +L++A+ YV+ SNIYAA + EN VH +R K
Sbjct: 635 ARRAADQLFNMEELRDAAPYVNMSNIYAAAGQWENVSKVHKAMRDRGVK 683


>tr|Q0CGG3|Q0CGG3_ASPTN Putative uncharacterized protein
OS=Aspergillus terreus (strain NIH 2624) GN=ATEG_07229
PE=4 SV=1
Length = 501

Score = 33.9 bits (76), Expect = 4.1
Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 2/53 (3%)
Frame = +1

Query: 145 FVTSFL*HYRETQSSRRVLPSNCPPTSSENIE--TTPSSASGHQDFPERFGDI 297
FV+SF + +SS P PPTSS+ + P ++G PE FGD+
Sbjct: 57 FVSSFSSRREQQRSSNNASPRPAPPTSSKKTKKPKAPLHSTGPPRRPENFGDV 109


>tr|Q2QNV4|Q2QNV4_ORYSJ Pentatricopeptide, putative, expressed
OS=Oryza sativa subsp. japonica GN=LOC_Os12g36620 PE=4
SV=2
Length = 1176

Score = 33.1 bits (74), Expect = 7.0
Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 5/60 (8%)
Frame = -2

Query: 431 RDAKLAMWAFKHADQLDLKEASTYVSFSNIYAADHRQENQEGVHMMSPNRS-----GKSW 267
++ ++ +A KH +L+ ++++YV SN YA + N++ V M +R G+SW
Sbjct: 730 KNIEVGEFAAKHLLELEPHDSASYVLLSNAYAVTEKWANRDQVRKMMRDRGVRKEPGRSW 789