BP919078
Clone id YMU001_000121_A05
Library
Length 533
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000121_A05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CACCCACAACCGTGGTGCCTGTCCATGTCGCAATAAGGTAGACAACCACTGTTGAGCATT
CCACTTTATAAAATAGGCTTCTTCTCCAAATCTAGGACGCCTCTTGAAGCCTTGATAAAA
TGTCAAATCTCCCACTTTGGCCCCCTTCTTTGTAATCCTATTGTTCGTACGGATCATACA
CACCAAGTCATAGAGGTGTGTGCCTTATGTGCCCAAGGTCGTAACAAAAATCCCCTTCGC
ACATGCTAGTGTTCCCACCCGGTGGAATCCATAAGGGTATCCTGGCATGCCACACATATC
GCCACACATCCCTCCATCTTTGCTCAAAAAGCGCCGAAGGACCTGCACCATACAGCACAA
ATGCACCTAGACCTGCTCCATAAGGATAGACTTCCATTGGAGGCATCACAAACTCGCTCT
TGCCTGCCATCTCTAAAAACATAGGATTCCTTCCTAGAAATCCTGAGAATGGTGGCAAAA
GTGCTAAAAGCACGTAAAACATCTACCCTTTTACTTGCCCCAGCCCACCATGA
■■Homology search results ■■ -
sp_hit_id Q619W9
Definition sp|Q619W9|VATH2_CAEBR Probable V-type proton ATPase subunit H 2 OS=Caenorhabditis briggsae
Align length 64
Score (bit) 33.1
E-value 0.86
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919078|Adiantum capillus-veneris mRNA, clone:
YMU001_000121_A05.
(533 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q619W9|VATH2_CAEBR Probable V-type proton ATPase subunit H 2 ... 33 0.86
sp|Q6B4Z3|UTY_PANTR Histone demethylase UTY OS=Pan troglodytes G... 33 0.86
sp|Q22494|VATH2_CAEEL Probable V-type proton ATPase subunit H 2 ... 31 3.3
sp|Q70EL1|UBP54_HUMAN Inactive ubiquitin carboxyl-terminal hydro... 31 3.3
sp|P41832|BNI1_YEAST Protein BNI1 OS=Saccharomyces cerevisiae GN... 31 3.3
sp|Q9VE34|U493_DROME UPF0493 protein CG14299 OS=Drosophila melan... 30 7.3
sp|P21849|TSA4_GIALA Major surface-labeled trophozoite antigen 4... 30 7.3
sp|P56848|ISPE_MENPI 4-diphosphocytidyl-2-C-methyl-D-erythritol ... 30 9.5
sp|Q6A0A9|F120A_MOUSE Constitutive coactivator of PPAR-gamma-lik... 30 9.5

>sp|Q619W9|VATH2_CAEBR Probable V-type proton ATPase subunit H 2
OS=Caenorhabditis briggsae GN=vha-15 PE=3 SV=1
Length = 470

Score = 33.1 bits (74), Expect = 0.86
Identities = 21/64 (32%), Positives = 31/64 (48%)
Frame = -1

Query: 452 KESYVFRDGRQERVCDASNGSLSLWSRSRCICAVWCRSFGAF*AKMEGCVAICVACQDTL 273
+ +V DG Q V A NG + + + I +VWC +F A AK + + A D L
Sbjct: 202 RHEFVVTDGVQTLVT-ALNGKTNFQLQYQLIFSVWCLTFNADIAKKTPSLGVITALGDIL 260

Query: 272 MDST 261
+ST
Sbjct: 261 SEST 264


>sp|Q6B4Z3|UTY_PANTR Histone demethylase UTY OS=Pan troglodytes GN=UTY
PE=2 SV=1
Length = 1079

Score = 33.1 bits (74), Expect = 0.86
Identities = 17/49 (34%), Positives = 24/49 (48%)
Frame = +1

Query: 268 SIRVSWHATHIATHPSIFAQKAPKDLHHTAQMHLDLLHKDRLPLEASQT 414
S+ SW+ H+ + P+ F HH Q HL+LL L ASQ+
Sbjct: 1020 SLPNSWNYRHLPSCPTNFCIFVETGFHHVGQAHLELLTSGGLLASASQS 1068


>sp|Q22494|VATH2_CAEEL Probable V-type proton ATPase subunit H 2
OS=Caenorhabditis elegans GN=vha-15 PE=2 SV=1
Length = 470

Score = 31.2 bits (69), Expect = 3.3
Identities = 21/64 (32%), Positives = 31/64 (48%)
Frame = -1

Query: 452 KESYVFRDGRQERVCDASNGSLSLWSRSRCICAVWCRSFGAF*AKMEGCVAICVACQDTL 273
+ +V DG Q V A NG + + + I AVWC +F A A+ + + A D L
Sbjct: 202 RHEFVDSDGVQTLVT-ALNGKTNFQLQYQLIFAVWCLTFNADIARKAPSLGLIQALGDIL 260

Query: 272 MDST 261
+ST
Sbjct: 261 SEST 264


>sp|Q70EL1|UBP54_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase
54 OS=Homo sapiens GN=USP54 PE=1 SV=4
Length = 1684

Score = 31.2 bits (69), Expect = 3.3
Identities = 14/61 (22%), Positives = 28/61 (45%)
Frame = +1

Query: 250 CSHPVESIRVSWHATHIATHPSIFAQKAPKDLHHTAQMHLDLLHKDRLPLEASQTRSCLP 429
C+ + +R++ H +TH K + A+ D + + + P + SQ +CLP
Sbjct: 823 CNEAISKLRLALHGASCSTHSRALVDKKLQISIRKARSLQDRMQQQQSPQQPSQPSACLP 882

Query: 430 S 432
+
Sbjct: 883 T 883


>sp|P41832|BNI1_YEAST Protein BNI1 OS=Saccharomyces cerevisiae
GN=BNI1 PE=1 SV=2
Length = 1953

Score = 31.2 bits (69), Expect = 3.3
Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 9/73 (12%)
Frame = -3

Query: 279 YPYGFHRVGTLACAKGIFVTTLGT*GTHLYDLVCMIRTNNR---------ITKKGAKVGD 127
Y + HR+ T A+G+F T L T VCM+ N+ + KK +
Sbjct: 425 YEFSTHRLMTDTVAEGLFSTKLATRKMATEIFVCMLEKKNKSRFEAVLTSLDKKFRIGQN 484

Query: 126 LTFYQGFKRRPRF 88
L Q FK+ P++
Sbjct: 485 LHMIQNFKKMPQY 497


>sp|Q9VE34|U493_DROME UPF0493 protein CG14299 OS=Drosophila
melanogaster GN=CG14299 PE=1 SV=1
Length = 2404

Score = 30.0 bits (66), Expect = 7.3
Identities = 15/23 (65%), Positives = 15/23 (65%)
Frame = -3

Query: 201 THLYDLVCMIRTNNRITKKGAKV 133
T LYDLVC TNN IT K KV
Sbjct: 269 TGLYDLVCHAYTNNSITAKITKV 291


>sp|P21849|TSA4_GIALA Major surface-labeled trophozoite antigen 417
OS=Giardia lamblia GN=TSA 417 PE=2 SV=1
Length = 713

Score = 30.0 bits (66), Expect = 7.3
Identities = 15/49 (30%), Positives = 23/49 (46%)
Frame = -1

Query: 431 DGRQERVCDASNGSLSLWSRSRCICAVWCRSFGAF*AKMEGCVAICVAC 285
+G++ VC +GS L S+CI + C G + EG +C C
Sbjct: 348 EGKENEVCTDCDGSTYLTPTSQCIDS--CAKIGNYYGATEGAKKLCKEC 394


>sp|P56848|ISPE_MENPI 4-diphosphocytidyl-2-C-methyl-D-erythritol
kinase, chloroplastic OS=Mentha piperita GN=ISPE PE=1
SV=1
Length = 405

Score = 29.6 bits (65), Expect = 9.5
Identities = 20/64 (31%), Positives = 28/64 (43%)
Frame = -3

Query: 204 GTHLYDLVCMIRTNNRITKKGAKVGDLTFYQGFKRRPRFGEEAYFIKWNAQQWLSTLLRH 25
G YD V M + + I G+ Y G + + F EA FI +A QW S L
Sbjct: 335 GRSQYDAVFMSGSGSTIVGVGSPDPPQFVYDGDEYKNIFFSEAKFITRSANQWYSEPLST 394

Query: 24 GQAP 13
++P
Sbjct: 395 DESP 398


>sp|Q6A0A9|F120A_MOUSE Constitutive coactivator of PPAR-gamma-like
protein 1 OS=Mus musculus GN=FAM120A PE=1 SV=2
Length = 1112

Score = 29.6 bits (65), Expect = 9.5
Identities = 16/44 (36%), Positives = 21/44 (47%)
Frame = +2

Query: 194 RCVPYVPKVVTKIPFAHASVPTRWNP*GYPGMPHISPHIPPSLL 325
R V Y +PF R NP G PGM + P++PP +L
Sbjct: 323 RAVGYYSATSKPMPFHPPHYLARPNPFGMPGM--VPPYVPPQML 364


tr_hit_id Q5CV82
Definition tr|Q5CV82|Q5CV82_CRYPV Putative uncharacterized protein OS=Cryptosporidium parvum Iowa II
Align length 42
Score (bit) 35.4
E-value 1.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919078|Adiantum capillus-veneris mRNA, clone:
YMU001_000121_A05.
(533 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q5CV82|Q5CV82_CRYPV Putative uncharacterized protein OS=Crypt... 35 1.8
tr|Q5CGQ3|Q5CGQ3_CRYHO Putative uncharacterized protein OS=Crypt... 35 1.8
tr|A7C109|A7C109_9GAMM Methyl-accepting chemotaxis sensory trans... 35 2.4
tr|A3UPU7|A3UPU7_VIBSP Hypothetical transposase OS=Vibrio splend... 35 3.2
tr|A1CS89|A1CS89_ASPCL AAA family ATPase, putative OS=Aspergillu... 34 4.1
tr|Q4RUB3|Q4RUB3_TETNG Chromosome 1 SCAF14995, whole genome shot... 34 5.4
tr|A4I0Q5|A4I0Q5_LEIIN Protein kinase, putative (Fragment) OS=Le... 34 5.4
tr|Q4WKL4|Q4WKL4_ASPFU Pachytene checkpoint component Pch2, puta... 34 5.4
tr|B0XRH0|B0XRH0_ASPFC AAA family ATPase, putative OS=Aspergillu... 34 5.4
tr|A1D555|A1D555_NEOFI Pachytene checkpoint component Pch2, puta... 34 5.4
tr|Q4QIV3|Q4QIV3_LEIMA Putative uncharacterized protein OS=Leish... 33 7.0
tr|B4KGI3|B4KGI3_DROMO GI11276 OS=Drosophila mojavensis GN=GI112... 33 7.0
tr|A6R2D3|A6R2D3_AJECN Predicted protein OS=Ajellomyces capsulat... 33 7.0
tr|A3YUG1|A3YUG1_9SYNE 1,4-dihydroxy-2-naphthoate octaprenyltran... 33 9.2
tr|A4HKE3|A4HKE3_LEIBR Putative uncharacterized protein OS=Leish... 33 9.2

>tr|Q5CV82|Q5CV82_CRYPV Putative uncharacterized protein
OS=Cryptosporidium parvum Iowa II GN=cgd8_5060 PE=4 SV=1
Length = 152

Score = 35.4 bits (80), Expect = 1.8
Identities = 17/42 (40%), Positives = 22/42 (52%)
Frame = -2

Query: 472 PFSGFLGRNPMFLEMAGKSEFVMPPMEVYPYGAGLGAFVLYG 347
P+S +G+N +F MAG S + PP P G GAF G
Sbjct: 38 PYSSGMGQNMVFQSMAGGSGYFFPPNGSAPMSMGSGAFASVG 79


>tr|Q5CGQ3|Q5CGQ3_CRYHO Putative uncharacterized protein
OS=Cryptosporidium hominis GN=Chro.80578 PE=4 SV=1
Length = 152

Score = 35.4 bits (80), Expect = 1.8
Identities = 17/42 (40%), Positives = 22/42 (52%)
Frame = -2

Query: 472 PFSGFLGRNPMFLEMAGKSEFVMPPMEVYPYGAGLGAFVLYG 347
P+S +G+N +F MAG S + PP P G GAF G
Sbjct: 38 PYSSGMGQNMVFQSMAGGSGYFFPPNGSAPMSMGSGAFASVG 79


>tr|A7C109|A7C109_9GAMM Methyl-accepting chemotaxis sensory
transducer OS=Beggiatoa sp. PS GN=BGP_2070 PE=4 SV=1
Length = 513

Score = 35.0 bits (79), Expect = 2.4
Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 2/86 (2%)
Frame = +1

Query: 277 VSWHATHIATHPS--IFAQKAPKDLHHTAQMHLDLLHKDRLPLEASQTRSCLPSLKT*DS 450
++ H H PS I ++ + + K + P+ ASQ R PS K ++
Sbjct: 394 ITTHGHHFVKQPSKSILLAESTTPQKEEIESQSETNPKIKKPITASQNRKRQPSQKVINN 453

Query: 451 FLEILRMVAKVLKARKTSTLLLAPAH 528
+LEI + ++KV+ A+ L A H
Sbjct: 454 YLEIAKEISKVMLAQTKLLTLTAAIH 479


>tr|A3UPU7|A3UPU7_VIBSP Hypothetical transposase OS=Vibrio
splendidus 12B01 GN=V12B01_17696 PE=4 SV=1
Length = 292

Score = 34.7 bits (78), Expect = 3.2
Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 4/69 (5%)
Frame = +3

Query: 177 YTPSHRGVCLMCPRS*QKSPSHMLVFPPGGIHKGILA-CHT---YRHTSLHLCSKSAEGP 344
+ P + G CL+ RS P + G+ KG A CH+ +H++ HL +SA+ P
Sbjct: 101 HKPKYLGHCLLAKRS----PISCEAYVYKGLEKGRKAQCHSRTSQKHSATHLYQRSAKEP 156

Query: 345 APYSTNAPR 371
+TN PR
Sbjct: 157 WLLATNVPR 165


>tr|A1CS89|A1CS89_ASPCL AAA family ATPase, putative OS=Aspergillus
clavatus GN=ACLA_032450 PE=3 SV=1
Length = 439

Score = 34.3 bits (77), Expect = 4.1
Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 1/51 (1%)
Frame = -2

Query: 382 YGAGLGAFVLYGAGPSALFEQRWRDVWRYVWHARIPLWIPPG-GNTSMCEG 233
Y L + +L F R D W W+ I LW PPG G TS+C G
Sbjct: 154 YDQPLQSTLLRAISRMVSFSARKLDKWTINWNRLILLWGPPGTGKTSLCRG 204


>tr|Q4RUB3|Q4RUB3_TETNG Chromosome 1 SCAF14995, whole genome shotgun
sequence OS=Tetraodon nigroviridis GN=GSTENG00028875001
PE=4 SV=1
Length = 437

Score = 33.9 bits (76), Expect = 5.4
Identities = 12/35 (34%), Positives = 23/35 (65%)
Frame = +1

Query: 325 QKAPKDLHHTAQMHLDLLHKDRLPLEASQTRSCLP 429
QK P +LHH + + L+++RLP + ++T + +P
Sbjct: 396 QKVPPELHHELPVSFEWLNRNRLPTQTNKTHALIP 430


>tr|A4I0Q5|A4I0Q5_LEIIN Protein kinase, putative (Fragment)
OS=Leishmania infantum GN=LinJ24.0320 PE=4 SV=1
Length = 1079

Score = 33.9 bits (76), Expect = 5.4
Identities = 27/91 (29%), Positives = 35/91 (38%), Gaps = 8/91 (8%)
Frame = +1

Query: 67 YKIGFFSKSRTPLEALIKC-----QISHFGPLLCNPIVRTDHTHQVIEVCA---LCAQGR 222
+K G S P +AL C I P LCN V TH +VCA L G
Sbjct: 944 HKNGNQRGSSQPQDALTSCVDGGDDILSAAPFLCNQDVNASVTHLAHKVCASVGLTGSGS 1003

Query: 223 NKNPLRTC*CSHPVESIRVSWHATHIATHPS 315
P C + P+ S+ H++ PS
Sbjct: 1004 GAAPTLRCAAASPLGSLVACTHSSQRHCTPS 1034


>tr|Q4WKL4|Q4WKL4_ASPFU Pachytene checkpoint component Pch2,
putative OS=Aspergillus fumigatus GN=AFUA_1G02060 PE=3
SV=2
Length = 455

Score = 33.9 bits (76), Expect = 5.4
Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
Frame = -2

Query: 328 FEQRWRDVWRYVWHARIPLWIPPG-GNTSMCEG 233
F R D W W+ I LW PPG G TS+C G
Sbjct: 161 FSARKLDKWTINWNRLILLWGPPGTGKTSLCRG 193


>tr|B0XRH0|B0XRH0_ASPFC AAA family ATPase, putative OS=Aspergillus
fumigatus (strain CEA10 / CBS 144.89 / FGSC A1163)
GN=AFUB_002440 PE=4 SV=1
Length = 481

Score = 33.9 bits (76), Expect = 5.4
Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
Frame = -2

Query: 328 FEQRWRDVWRYVWHARIPLWIPPG-GNTSMCEG 233
F R D W W+ I LW PPG G TS+C G
Sbjct: 204 FSARKLDKWTINWNRLILLWGPPGTGKTSLCRG 236


>tr|A1D555|A1D555_NEOFI Pachytene checkpoint component Pch2,
putative OS=Neosartorya fischeri (strain ATCC 1020 / DSM
3700 / NRRL 181) GN=NFIA_022590 PE=3 SV=1
Length = 458

Score = 33.9 bits (76), Expect = 5.4
Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
Frame = -2

Query: 328 FEQRWRDVWRYVWHARIPLWIPPG-GNTSMCEG 233
F R D W W+ I LW PPG G TS+C G
Sbjct: 164 FSARKLDKWTINWNRLILLWGPPGTGKTSLCRG 196