BP919083
Clone id YMU001_000121_A10
Library
Length 422
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000121_A10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCGGAGCGAGTACAAGGCTGAGTATACAGGTACCATTGTCCCCCTCATTGTCGACATATC
CATCACGCGTGCTCTCCACTCTCTCTCTCTCTCAAACACACAGAGCTATTGCGTACGACG
TACACCTCTGAGGCACCTCTCTCTCTCTCTCTCTCTCGTCTTTTACTAGGAAAGCTTTAC
CTGCCCTCTTTCTCTCTTTCTATTACTGCGCGCGCACAACTCGGTGCAGCTATGATATCG
CCTGGCAAGTGATGATTGACCCGTCTGTTGTAGTTACTGCCCAGCTCTTGTTGCTGCTGC
TGCTTGCTTATGAAATCAAGGACATCAGCTAGTTGGGCACCTAGCCAACCTCTGCATCAG
CAGCCCATCACACGCTGCTGCTGCTGCTGCTGCCTCTGTTACCGATGCCGCAGGCCCTCT
AT
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919083|Adiantum capillus-veneris mRNA, clone:
YMU001_000121_A10.
(422 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id A9V3J9
Definition tr|A9V3J9|A9V3J9_MONBE Predicted protein OS=Monosiga brevicollis
Align length 59
Score (bit) 34.3
E-value 3.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919083|Adiantum capillus-veneris mRNA, clone:
YMU001_000121_A10.
(422 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9V3J9|A9V3J9_MONBE Predicted protein OS=Monosiga brevicollis... 34 3.1
tr|Q6CGM2|Q6CGM2_YARLI YALI0A18161p OS=Yarrowia lipolytica GN=YA... 33 9.2

>tr|A9V3J9|A9V3J9_MONBE Predicted protein OS=Monosiga brevicollis
GN=33183 PE=4 SV=1
Length = 740

Score = 34.3 bits (77), Expect = 3.1
Identities = 26/59 (44%), Positives = 34/59 (57%)
Frame = +2

Query: 56 ISITRALHSLSLSNTQSYCVRRTPLRHLSLSLSLVFY*ESFTCPLSLFLLLRAHNSVQL 232
+S++ +LHSLSLS + S CV + LSLSLSL S + LSL L L S+ L
Sbjct: 14 LSLSLSLHSLSLSLSLSLCVSLSLSLSLSLSLSLCL---SLSLSLSLSLSLSLSLSLSL 69


>tr|Q6CGM2|Q6CGM2_YARLI YALI0A18161p OS=Yarrowia lipolytica
GN=YALI0A18161g PE=4 SV=1
Length = 385

Score = 32.7 bits (73), Expect = 9.2
Identities = 24/64 (37%), Positives = 31/64 (48%), Gaps = 8/64 (12%)
Frame = -2

Query: 193 RKRAGKAFLVKDEREREREVPQRCTSYAIALCV--------*ERERVESTRDGYVDNEGD 38
RKR+G A + E ERER + R + A+AL + ERER R EG+
Sbjct: 323 RKRSGAAISISSEYERERTLLMRGSEAAVALAMSMLQQQMDEERER----RAQVGSEEGN 378

Query: 37 NGTC 26
NG C
Sbjct: 379 NGFC 382