BP919086
Clone id YMU001_000121_B01
Library
Length 435
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000121_B01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AATAGGGAAGACGAGCAGCCGCTACCTTTGCTTTACAATCCTCATTTGATGTGAAGTAAC
AATCGTACAAGTTCTTGTTAGCAGTCACAATATTTTCCTTCTTTGCTTTCGCGATCATAC
TGAGATACCATTCACGAAGCTTATCTGTGTTGGGGGTCTTCTGAATCTCAGGATGACAAT
ACAAGATGTAGTCGTCTCCCTTGAGTGGCGGACAAGCCCAAATGTAGCAACTGCTAAACC
CTCTCCTCTTGCAATAATCCAGGTAGGCAACCAGTATCTCATGATACACATAAGTCCGAA
GAGCTTCTCCTGTTACTGTCTTGACATCTGGTCTGAAATATTTGACAGAATCCAGATATG
AAAGATAAACATGGCGGTGATTTGGTTGGGGAGACTCTGTGCCAAACTCTTGCAGAGTAC
CTGCAGGTAATATCT
■■Homology search results ■■ -
sp_hit_id Q9LE42
Definition sp|Q9LE42|HAC5_ARATH Histone acetyltransferase HAC5 OS=Arabidopsis thaliana
Align length 138
Score (bit) 234.0
E-value 9.0e-62
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919086|Adiantum capillus-veneris mRNA, clone:
YMU001_000121_B01.
(435 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LE42|HAC5_ARATH Histone acetyltransferase HAC5 OS=Arabidops... 234 9e-62
sp|Q9LG11|HAC4_ARATH Histone acetyltransferase HAC4 OS=Arabidops... 228 1e-59
sp|Q6YXY2|HACL1_ORYSJ Probable histone acetyltransferase HAC-lik... 226 2e-59
sp|Q9FWQ5|HAC12_ARATH Histone acetyltransferase HAC12 OS=Arabido... 226 4e-59
sp|Q5Z8V7|HACL2_ORYSJ Probable histone acetyltransferase HAC-lik... 222 5e-58
sp|Q9C5X9|HAC1_ARATH Histone acetyltransferase HAC1 OS=Arabidops... 221 8e-58
sp|Q9XHY7|HACL3_ORYSJ Probable histone acetyltransferase HAC-lik... 194 1e-49
sp|Q9FYH1|HAC2_ARATH Histone acetyltransferase HAC2 OS=Arabidops... 177 2e-44
sp|Q09472|EP300_HUMAN Histone acetyltransferase p300 OS=Homo sap... 134 1e-31
sp|Q92793|CBP_HUMAN CREB-binding protein OS=Homo sapiens GN=CREB... 130 2e-30
sp|P34545|CBP1_CAEEL Protein cbp-1 OS=Caenorhabditis elegans GN=... 125 6e-29
sp|P45481|CBP_MOUSE CREB-binding protein OS=Mus musculus GN=Creb... 115 1e-25
sp|A6LSX9|META_CLOB8 Homoserine O-succinyltransferase OS=Clostri... 33 0.39
sp|P13442|NODQ_RHIME Bifunctional enzyme nodQ OS=Rhizobium melil... 30 3.3
sp|Q5BEK7|END3_EMENI Actin cytoskeleton-regulatory complex prote... 29 9.6

>sp|Q9LE42|HAC5_ARATH Histone acetyltransferase HAC5 OS=Arabidopsis
thaliana GN=HAC5 PE=2 SV=1
Length = 1670

Score = 234 bits (598), Expect = 9e-62
Identities = 104/138 (75%), Positives = 119/138 (86%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QEFGT+S PN R VYLSYLDSVKYFRPDV+TV+GEALRT+VYHEIL+ YLDYCK+RGF
Sbjct: 1164 VQEFGTDSASPNQRRVYLSYLDSVKYFRPDVRTVSGEALRTFVYHEILIGYLDYCKKRGF 1223

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
SSCYIWACPPLKG+DYILYCHPEIQKTP TDKLREWYL+M+ KA KE +V N YD +
Sbjct: 1224 SSCYIWACPPLKGEDYILYCHPEIQKTPKTDKLREWYLAMLKKASKEKVVVECTNFYDHF 1283

Query: 55 FTSNEDCKAKVAAARLPY 2
F + +C+AKV AARLPY
Sbjct: 1284 FVQSGECRAKVTAARLPY 1301


>sp|Q9LG11|HAC4_ARATH Histone acetyltransferase HAC4 OS=Arabidopsis
thaliana GN=HAC4 PE=2 SV=2
Length = 1470

Score = 228 bits (580), Expect = 1e-59
Identities = 101/138 (73%), Positives = 118/138 (85%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QEFGT+S PN R VYLSYLDSVKYFRP +TV+GEALRT+VYHEIL+ YLDYCK+RGF
Sbjct: 959 VQEFGTDSGPPNERRVYLSYLDSVKYFRPTFRTVSGEALRTFVYHEILIGYLDYCKKRGF 1018

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
+SCYIWACPPLKGDDYILYCHPEIQKTP TDKLREWYL+M+ KA KE++V NLY+ +
Sbjct: 1019 TSCYIWACPPLKGDDYILYCHPEIQKTPKTDKLREWYLAMLRKASKEDVVVECTNLYNHF 1078

Query: 55 FTSNEDCKAKVAAARLPY 2
F + +C+A V AARLPY
Sbjct: 1079 FVQSGECRANVTAARLPY 1096


>sp|Q6YXY2|HACL1_ORYSJ Probable histone acetyltransferase HAC-like 1
OS=Oryza sativa subsp. japonica GN=Os02g0137500 PE=3 SV=2
Length = 1668

Score = 226 bits (577), Expect = 2e-59
Identities = 101/138 (73%), Positives = 118/138 (85%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QEFG E PN R VYLSYLDSVKYFRP+++TV+GEALRT+VYHEIL+ YL+YCK+RGF
Sbjct: 1197 VQEFGAECSYPNQRRVYLSYLDSVKYFRPEIRTVSGEALRTFVYHEILIGYLEYCKQRGF 1256

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
+SCYIWACPPLKG+DYILYCHPEIQKTP +DKLREWYLSM+ KA KE IV NLYD +
Sbjct: 1257 TSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLSMLRKATKEEIVVELTNLYDHF 1316

Query: 55 FTSNEDCKAKVAAARLPY 2
F + +CKAKV A+RLPY
Sbjct: 1317 FITMGECKAKVTASRLPY 1334


>sp|Q9FWQ5|HAC12_ARATH Histone acetyltransferase HAC12 OS=Arabidopsis
thaliana GN=HAC12 PE=2 SV=2
Length = 1706

Score = 226 bits (575), Expect = 4e-59
Identities = 100/138 (72%), Positives = 115/138 (83%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QEFG+E PN R VYLSYLDSVKYFRPD+K+ GEALRT+VYHEIL+ YL+YCK RGF
Sbjct: 1193 VQEFGSECSNPNQRRVYLSYLDSVKYFRPDIKSANGEALRTFVYHEILIGYLEYCKLRGF 1252

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
+SCYIWACPPLKG+DYILYCHPEIQKTP +DKLREWYL+M+ KA KE IV NLYD +
Sbjct: 1253 TSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLAMLRKAAKEGIVAETTNLYDHF 1312

Query: 55 FTSNEDCKAKVAAARLPY 2
F +C+AKV AARLPY
Sbjct: 1313 FLQTGECRAKVTAARLPY 1330


>sp|Q5Z8V7|HACL2_ORYSJ Probable histone acetyltransferase HAC-like 2
OS=Oryza sativa subsp. japonica GN=Os06g0704800 PE=3 SV=2
Length = 1439

Score = 222 bits (566), Expect = 5e-58
Identities = 99/138 (71%), Positives = 119/138 (86%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QE+G E PN R VYLSYLDSVKYFRPD++TV+G+ALRTYVYHEIL+ YL+Y K+RGF
Sbjct: 1051 VQEYGAECKFPNQRRVYLSYLDSVKYFRPDIETVSGQALRTYVYHEILIGYLEYYKQRGF 1110

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
+SCYIWACPP+KG+DYILYCHPEIQKTP +DKLR+WYLSM+ KA KENIV NLYD +
Sbjct: 1111 TSCYIWACPPVKGEDYILYCHPEIQKTPKSDKLRQWYLSMLQKAIKENIVVELTNLYDQF 1170

Query: 55 FTSNEDCKAKVAAARLPY 2
F + ++CK KV+AARLPY
Sbjct: 1171 FVTAKECKIKVSAARLPY 1188


>sp|Q9C5X9|HAC1_ARATH Histone acetyltransferase HAC1 OS=Arabidopsis
thaliana GN=HAC1 PE=1 SV=1
Length = 1654

Score = 221 bits (564), Expect = 8e-58
Identities = 99/138 (71%), Positives = 115/138 (83%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QEFG+E PN R VYLSYLDSVKYFRP+V++ GEALRT+VYHEIL+ YL+YCK RGF
Sbjct: 1178 VQEFGSECAFPNQRRVYLSYLDSVKYFRPEVRSYNGEALRTFVYHEILIGYLEYCKLRGF 1237

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
+SCYIWACPPLKG+DYILYCHPEIQKTP +DKLREWYL+M+ KA KE IV NLYD +
Sbjct: 1238 TSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLAMLRKASKEGIVAETINLYDHF 1297

Query: 55 FTSNEDCKAKVAAARLPY 2
F +C+AKV AARLPY
Sbjct: 1298 FMQTGECRAKVTAARLPY 1315


>sp|Q9XHY7|HACL3_ORYSJ Probable histone acetyltransferase HAC-like 3
OS=Oryza sativa subsp. japonica GN=Os01g0246100 PE=2 SV=2
Length = 1276

Score = 194 bits (494), Expect = 1e-49
Identities = 81/138 (58%), Positives = 104/138 (75%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QE+G+ P PN RHVYL+Y+DSVKYFRP++K+ +GEALRT+VYHEIL+ YLD+CK+RGF
Sbjct: 807 VQEYGSACPSPNQRHVYLAYIDSVKYFRPEIKSASGEALRTFVYHEILIGYLDFCKKRGF 866

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
SC IW CP K DDY+LYCHP IQK P +DKLR WY +++ KA KE +V LYD +
Sbjct: 867 VSCSIWTCPSTKRDDYVLYCHPTIQKMPKSDKLRSWYQNLVKKAVKEGVVVERNTLYDFF 926

Query: 55 FTSNEDCKAKVAAARLPY 2
+CK ++AA LPY
Sbjct: 927 LQPTNECKTNISAAWLPY 944


>sp|Q9FYH1|HAC2_ARATH Histone acetyltransferase HAC2 OS=Arabidopsis
thaliana GN=HAC2 PE=2 SV=1
Length = 1357

Score = 177 bits (448), Expect = 2e-44
Identities = 80/138 (57%), Positives = 104/138 (75%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QEFG+E QPN R Y+ YLDSVKYF+P+ T GEALRT+VYHE+L+ YL+YCK RGF
Sbjct: 883 VQEFGSECSQPNQRSTYIFYLDSVKYFKPERVTFAGEALRTFVYHEVLIGYLEYCKLRGF 942

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
++ YIWACPP G DYI+Y HP+ Q+TP+T KLR+WY+SM+ KA ++ +V NLYD +
Sbjct: 943 TTSYIWACPPKIGQDYIMYSHPKTQQTPDTKKLRKWYVSMLQKAAEQRVVMNVTNLYDRF 1002

Query: 55 FTSNEDCKAKVAAARLPY 2
F S E+ + AARLPY
Sbjct: 1003 FDSTEE---YMTAARLPY 1017


>sp|Q09472|EP300_HUMAN Histone acetyltransferase p300 OS=Homo sapiens
GN=EP300 PE=1 SV=2
Length = 2414

Score = 134 bits (338), Expect = 1e-31
Identities = 67/138 (48%), Positives = 89/138 (64%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QE+G++ P PN R VY+SYLDSV +FRP + LRT VYHEIL+ YL+Y K+ G+
Sbjct: 1378 VQEYGSDCPPPNQRRVYISYLDSVHFFRP-------KCLRTAVYHEILIGYLEYVKKLGY 1430

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
++ +IWACPP +GDDYI +CHP QK P +L+EWY M+ KA E IV K D +
Sbjct: 1431 TTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYK---DIF 1487

Query: 55 FTSNEDCKAKVAAARLPY 2
+ ED +A LPY
Sbjct: 1488 KQATED--RLTSAKELPY 1503


>sp|Q92793|CBP_HUMAN CREB-binding protein OS=Homo sapiens GN=CREBBP
PE=1 SV=3
Length = 2442

Score = 130 bits (328), Expect = 2e-30
Identities = 65/138 (47%), Positives = 87/138 (63%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QE+G++ P PN R VY+SYLDS+ +FRP LRT VYHEIL+ YL+Y K+ G+
Sbjct: 1414 VQEYGSDCPPPNTRRVYISYLDSIHFFRP-------RCLRTAVYHEILIGYLEYVKKLGY 1466

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
+ +IWACPP +GDDYI +CHP QK P +L+EWY M+ KA E I+ K D +
Sbjct: 1467 VTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYK---DIF 1523

Query: 55 FTSNEDCKAKVAAARLPY 2
+ ED +A LPY
Sbjct: 1524 KQATED--RLTSAKELPY 1539


tr_hit_id A9U3C0
Definition tr|A9U3C0|A9U3C0_PHYPA p300/CBP acetyltransferase-related protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 138
Score (bit) 231.0
E-value 1.0e-59
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919086|Adiantum capillus-veneris mRNA, clone:
YMU001_000121_B01.
(435 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9U3C0|A9U3C0_PHYPA p300/CBP acetyltransferase-related protei... 231 1e-59
tr|A9TAD6|A9TAD6_PHYPA p300/CBP acetyltransferase-related protei... 231 1e-59
tr|A7Q4K1|A7Q4K1_VITVI Chromosome chr9 scaffold_49, whole genome... 231 1e-59
tr|A5B4P5|A5B4P5_VITVI Putative uncharacterized protein OS=Vitis... 231 1e-59
tr|B8AHD6|B8AHD6_ORYSI Putative uncharacterized protein OS=Oryza... 226 3e-58
tr|A3A2Y4|A3A2Y4_ORYSJ Putative uncharacterized protein OS=Oryza... 226 3e-58
tr|A2YGS5|A2YGS5_ORYSI Putative uncharacterized protein OS=Oryza... 225 7e-58
tr|A3BF71|A3BF71_ORYSJ Putative uncharacterized protein OS=Oryza... 222 6e-57
tr|A7PAN0|A7PAN0_VITVI Chromosome chr14 scaffold_9, whole genome... 216 3e-55
tr|A5C9C3|A5C9C3_VITVI Putative uncharacterized protein OS=Vitis... 214 2e-54
tr|B8ABH1|B8ABH1_ORYSI Putative uncharacterized protein OS=Oryza... 194 1e-48
tr|A2ZR86|A2ZR86_ORYSJ Putative uncharacterized protein OS=Oryza... 194 1e-48
tr|A4RWA9|A4RWA9_OSTLU Predicted protein OS=Ostreococcus lucimar... 186 7e-46
tr|Q01AN4|Q01AN4_OSTTA CREB binding protein/P300 and related TAZ... 182 7e-45
tr|A8IRU2|A8IRU2_CHLRE CREB-binding protein OS=Chlamydomonas rei... 160 3e-38
tr|B7FZQ7|B7FZQ7_PHATR Predicted protein OS=Phaeodactylum tricor... 149 5e-35
tr|B7FZC4|B7FZC4_PHATR Predicted protein OS=Phaeodactylum tricor... 149 5e-35
tr|B8LBX3|B8LBX3_THAPS Predicted protein OS=Thalassiosira pseudo... 142 6e-33
tr|B8LBW8|B8LBW8_THAPS Putative uncharacterized protein ZFP14 (F... 138 1e-31
tr|B6N919|B6N919_BRAFL Putative uncharacterized protein OS=Branc... 136 6e-31
tr|Q4S4B6|Q4S4B6_TETNG Chromosome 2 SCAF14738, whole genome shot... 135 1e-30
tr|Q28E87|Q28E87_XENTR E1A binding protein p300 (Fragment) OS=Xe... 135 1e-30
tr|Q7Z6C1|Q7Z6C1_HUMAN EP300 protein (Fragment) OS=Homo sapiens ... 134 2e-30
tr|Q1RLD3|Q1RLD3_CIOIN Zinc finger protein (Fragment) OS=Ciona i... 134 2e-30
tr|Q8QZV8|Q8QZV8_MOUSE CREB-binding protein (Fragment) OS=Mus mu... 134 3e-30
tr|Q6JHU9|Q6JHU9_RAT CREB-binding protein OS=Rattus norvegicus G... 134 3e-30
tr|Q6GQV9|Q6GQV9_MOUSE Crebbp protein (Fragment) OS=Mus musculus... 134 3e-30
tr|Q4SVN3|Q4SVN3_TETNG Chromosome undetermined SCAF13749, whole ... 133 5e-30
tr|B2RWS6|B2RWS6_MOUSE Ep300 protein OS=Mus musculus GN=Ep300 PE... 133 5e-30
tr|B1PM12|B1PM12_CTEID E1A binding protein p300 (Fragment) OS=Ct... 132 1e-29

>tr|A9U3C0|A9U3C0_PHYPA p300/CBP acetyltransferase-related protein
(Fragment) OS=Physcomitrella patens subsp. patens
GN=HAC1502 PE=4 SV=1
Length = 1082

Score = 231 bits (589), Expect = 1e-59
Identities = 104/138 (75%), Positives = 117/138 (84%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QEFG E PN R VYLSYLDSVKYFRPDV+TV GEALRT+VYHEIL+ YLDYC+RRGF
Sbjct: 576 VQEFGVECSLPNQRRVYLSYLDSVKYFRPDVRTVNGEALRTFVYHEILIGYLDYCRRRGF 635

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
SSCYIWACPPLKG+DYILYCHPEIQKTP +DKLR+WYL+M+ KA + IV NLYD +
Sbjct: 636 SSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLRDWYLAMLRKASTDGIVVEITNLYDYF 695

Query: 55 FTSNEDCKAKVAAARLPY 2
FTS +CKAKV AARLPY
Sbjct: 696 FTSTGECKAKVTAARLPY 713


>tr|A9TAD6|A9TAD6_PHYPA p300/CBP acetyltransferase-related protein
(Fragment) OS=Physcomitrella patens subsp. patens
GN=HAC1501 PE=4 SV=1
Length = 1617

Score = 231 bits (589), Expect = 1e-59
Identities = 104/138 (75%), Positives = 117/138 (84%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QEFG E PN R VYLSYLDSVKYFRPDV+TV GEALRT+VYHEIL+ YLDYC+RRGF
Sbjct: 1111 VQEFGMECSLPNQRRVYLSYLDSVKYFRPDVRTVNGEALRTFVYHEILIGYLDYCRRRGF 1170

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
SSCYIWACPPLKG+DYILYCHPEIQKTP +DKLR+WYL+M+ KA + IV NLYD +
Sbjct: 1171 SSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLRDWYLTMLRKASNDGIVVEITNLYDYF 1230

Query: 55 FTSNEDCKAKVAAARLPY 2
FTS +CKAKV AARLPY
Sbjct: 1231 FTSTGECKAKVTAARLPY 1248


>tr|A7Q4K1|A7Q4K1_VITVI Chromosome chr9 scaffold_49, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00029724001
PE=4 SV=1
Length = 1388

Score = 231 bits (589), Expect = 1e-59
Identities = 104/138 (75%), Positives = 120/138 (86%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QEFG+E PN R VYLSYLDSVKYFRP++K+VTGEALRT+VYHEIL+ YL+YCK+RGF
Sbjct: 875 VQEFGSECLFPNQRRVYLSYLDSVKYFRPEIKSVTGEALRTFVYHEILIGYLEYCKKRGF 934

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
+SCYIWACPPLKG+DYILYCHPEIQKTP +DKLREWYLSM+ KA KENIV NLYD +
Sbjct: 935 TSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLSMLRKAAKENIVVDLTNLYDHF 994

Query: 55 FTSNEDCKAKVAAARLPY 2
F S +CK+KV AARLPY
Sbjct: 995 FVSTGECKSKVTAARLPY 1012


>tr|A5B4P5|A5B4P5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_029037 PE=4 SV=1
Length = 1801

Score = 231 bits (589), Expect = 1e-59
Identities = 104/138 (75%), Positives = 120/138 (86%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QEFG+E PN R VYLSYLDSVKYFRP++K+VTGEALRT+VYHEIL+ YL+YCK+RGF
Sbjct: 1282 VQEFGSECLFPNQRRVYLSYLDSVKYFRPEIKSVTGEALRTFVYHEILIGYLEYCKKRGF 1341

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
+SCYIWACPPLKG+DYILYCHPEIQKTP +DKLREWYLSM+ KA KENIV NLYD +
Sbjct: 1342 TSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLSMLRKAXKENIVVDLTNLYDHF 1401

Query: 55 FTSNEDCKAKVAAARLPY 2
F S +CK+KV AARLPY
Sbjct: 1402 FVSTGECKSKVTAARLPY 1419


>tr|B8AHD6|B8AHD6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_05772 PE=4 SV=1
Length = 1712

Score = 226 bits (577), Expect = 3e-58
Identities = 101/138 (73%), Positives = 118/138 (85%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QEFG E PN R VYLSYLDSVKYFRP+++TV+GEALRT+VYHEIL+ YL+YCK+RGF
Sbjct: 1201 VQEFGAECSYPNQRRVYLSYLDSVKYFRPEIRTVSGEALRTFVYHEILIGYLEYCKQRGF 1260

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
+SCYIWACPPLKG+DYILYCHPEIQKTP +DKLREWYLSM+ KA KE IV NLYD +
Sbjct: 1261 TSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLSMLRKATKEEIVVELTNLYDHF 1320

Query: 55 FTSNEDCKAKVAAARLPY 2
F + +CKAKV A+RLPY
Sbjct: 1321 FITMGECKAKVTASRLPY 1338


>tr|A3A2Y4|A3A2Y4_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_005156 PE=4 SV=1
Length = 1623

Score = 226 bits (577), Expect = 3e-58
Identities = 101/138 (73%), Positives = 118/138 (85%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QEFG E PN R VYLSYLDSVKYFRP+++TV+GEALRT+VYHEIL+ YL+YCK+RGF
Sbjct: 1152 VQEFGAECSYPNQRRVYLSYLDSVKYFRPEIRTVSGEALRTFVYHEILIGYLEYCKQRGF 1211

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
+SCYIWACPPLKG+DYILYCHPEIQKTP +DKLREWYLSM+ KA KE IV NLYD +
Sbjct: 1212 TSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLSMLRKATKEEIVVELTNLYDHF 1271

Query: 55 FTSNEDCKAKVAAARLPY 2
F + +CKAKV A+RLPY
Sbjct: 1272 FITMGECKAKVTASRLPY 1289


>tr|A2YGS5|A2YGS5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_24386 PE=4 SV=1
Length = 1638

Score = 225 bits (574), Expect = 7e-58
Identities = 99/138 (71%), Positives = 120/138 (86%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QE+G E PN R VYLSYLDSVKYFRPD++TV+G+ALRTYVYHEIL+ YL+YCK+RGF
Sbjct: 1148 VQEYGAECKFPNQRRVYLSYLDSVKYFRPDIETVSGQALRTYVYHEILIGYLEYCKQRGF 1207

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
+SCYIWACPP+KG+DYILYCHPEIQKTP +DKLR+WYLSM+ KA KENIV NLYD +
Sbjct: 1208 TSCYIWACPPVKGEDYILYCHPEIQKTPKSDKLRQWYLSMLQKAIKENIVVELTNLYDQF 1267

Query: 55 FTSNEDCKAKVAAARLPY 2
F + ++CK KV+A+RLPY
Sbjct: 1268 FVTAKECKIKVSASRLPY 1285


>tr|A3BF71|A3BF71_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_021693 PE=4 SV=1
Length = 1439

Score = 222 bits (566), Expect = 6e-57
Identities = 99/138 (71%), Positives = 119/138 (86%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QE+G E PN R VYLSYLDSVKYFRPD++TV+G+ALRTYVYHEIL+ YL+Y K+RGF
Sbjct: 1051 VQEYGAECKFPNQRRVYLSYLDSVKYFRPDIETVSGQALRTYVYHEILIGYLEYYKQRGF 1110

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
+SCYIWACPP+KG+DYILYCHPEIQKTP +DKLR+WYLSM+ KA KENIV NLYD +
Sbjct: 1111 TSCYIWACPPVKGEDYILYCHPEIQKTPKSDKLRQWYLSMLQKAIKENIVVELTNLYDQF 1170

Query: 55 FTSNEDCKAKVAAARLPY 2
F + ++CK KV+AARLPY
Sbjct: 1171 FVTAKECKIKVSAARLPY 1188


>tr|A7PAN0|A7PAN0_VITVI Chromosome chr14 scaffold_9, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038188001
PE=4 SV=1
Length = 581

Score = 216 bits (551), Expect = 3e-55
Identities = 96/138 (69%), Positives = 112/138 (81%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QEFG+E QPN R VY+SYLDSVKYFRPD+ TV GEALRT+VY+EIL+ YLDYCK+RGF
Sbjct: 233 VQEFGSECRQPNQRSVYISYLDSVKYFRPDIATVGGEALRTFVYNEILIGYLDYCKKRGF 292

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
++CY+W+CPPLKG+DYILYCHP QKTP TDKLR+WY SM+AKA KENI NLYD +
Sbjct: 293 TTCYLWSCPPLKGEDYILYCHPRTQKTPKTDKLRQWYRSMLAKAAKENIAVELTNLYDHF 352

Query: 55 FTSNEDCKAKVAAARLPY 2
F C KV AARLPY
Sbjct: 353 FIPTGKCNTKVTAARLPY 370


>tr|A5C9C3|A5C9C3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_003620 PE=4 SV=1
Length = 2197

Score = 214 bits (545), Expect = 2e-54
Identities = 95/138 (68%), Positives = 111/138 (80%)
Frame = -3

Query: 415 LQEFGTESPQPNHRHVYLSYLDSVKYFRPDVKTVTGEALRTYVYHEILVAYLDYCKRRGF 236
+QEFG+E QPN R VY+SYLDSVKYFRPD+ TV GEALRT+VY+EIL+ YLDYCK+RGF
Sbjct: 1830 VQEFGSECRQPNQRSVYISYLDSVKYFRPDIATVGGEALRTFVYNEILIGYLDYCKKRGF 1889

Query: 235 SSCYIWACPPLKGDDYILYCHPEIQKTPNTDKLREWYLSMIAKAKKENIVTANKNLYDCY 56
++CY+W+CPPLKG+DYILYCHP QKTP DKLR+WY SM+AKA KENI NLYD +
Sbjct: 1890 TTCYLWSCPPLKGEDYILYCHPRTQKTPKXDKLRQWYRSMLAKAAKENIAVZLTNLYDHF 1949

Query: 55 FTSNEDCKAKVAAARLPY 2
F C KV AARLPY
Sbjct: 1950 FIPTGKCNTKVTAARLPY 1967