BP919103
Clone id YMU001_000121_C06
Library
Length 601
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000121_C06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GACTAGAAAAGCATAGAGCAACTTGTCATTTTAAAGTTTGATTTAAAGTCACTTTGCAAA
AGCCGCAGCCCCTGACATAACCTTCCGGTTCACCATTCTCAGAACTTTGCCCCATTCTAG
CAAACAATACCAGGCACCAACCTAAACTTACTCATTTGGTTCAAGAAGCAAATACAAGTG
GTAGCAGGAGCATGAAGTAGTAACGTCTCTCAAAAATGCTCTTTGACAAATTTGTGCATA
AAGAAGCCTTGAAGATAGTCACTACCTGCCTCGTTGACTAACTTTCATCATCTTCAGGAA
AAGCACAACAGCATGAAAGGCCCGTACAAGAAACTGCATAACTATCAACACGCATCCATC
GAACGTAAGCAGCAGCTTGGAAGACCATTCCAGAGTATTGTCTGCACTCTAAACACGTTT
CTTGCAGGTCCCCTGTAGCTCATTGACCACCTTGAGCCAAAGAGAACCAGAGAAAGAGAG
AGAGTTCATAATGTGTTCTTGAGAAGGAGAAATTTACAACCCTTGAAGTTTCCATTGATT
ATCTACAGTCCAGGTCTCCTGAGCTTCTTGATCGACATTTAACTTTTCAAAAAATGGGGC
G
■■Homology search results ■■ -
sp_hit_id Q9SMU4
Definition sp|Q9SMU4|U496N_ARATH UPF0496 protein At3g49070 OS=Arabidopsis thaliana
Align length 74
Score (bit) 33.5
E-value 0.85
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919103|Adiantum capillus-veneris mRNA, clone:
YMU001_000121_C06.
(601 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SMU4|U496N_ARATH UPF0496 protein At3g49070 OS=Arabidopsis t... 33 0.85
sp|Q84TX2|SCRL1_ORYSJ SCAR-like protein 1 OS=Oryza sativa subsp.... 30 9.4

>sp|Q9SMU4|U496N_ARATH UPF0496 protein At3g49070 OS=Arabidopsis
thaliana GN=At3g49070 PE=2 SV=1
Length = 416

Score = 33.5 bits (75), Expect = 0.85
Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 3/74 (4%)
Frame = +1

Query: 274 LTNFHHLQEKHNSMKGPYKKLHNYQHASIERKQQLGR---PFQSIVCTLNTFLAGPL*LI 444
L N HHL+ K+ S+K + ++ A I++ ++ + PF S + +G L L+
Sbjct: 172 LKNIHHLRSKYESLKPKFHSENHNSLALIDQFTEISKWFDPFISSGSRIQLIRSGCLYLL 231

Query: 445 DHLEPKRTRERERV 486
LE +R + R ++
Sbjct: 232 KRLESRRDKTRAKL 245


>sp|Q84TX2|SCRL1_ORYSJ SCAR-like protein 1 OS=Oryza sativa subsp.
japonica GN=Os03g0816900 PE=2 SV=2
Length = 2097

Score = 30.0 bits (66), Expect = 9.4
Identities = 16/44 (36%), Positives = 23/44 (52%)
Frame = +1

Query: 268 ASLTNFHHLQEKHNSMKGPYKKLHNYQHASIERKQQLGRPFQSI 399
ASL+N HH H+S K +K +SIE + +PF S+
Sbjct: 533 ASLSNDHHAVIAHSSDKQSSQKSSGLDGSSIESNDFIEKPFHSL 576


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919103|Adiantum capillus-veneris mRNA, clone:
YMU001_000121_C06.
(601 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******