BP919105
Clone id YMU001_000121_C08
Library
Length 466
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000121_C08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGTGATTGCTCCAAGACGCATCTCTTGCAAATGCAGGAGAAGCCAAACCTCATGTCTTGA
AAAGCCTTTTGCCGGGCCTGAAGCAGAGCCAGAATATCCACATACGTTATAGTGATTTCC
TCGCCCTTGCGGATTTCTGCAGCTGCATGAATGACCATGGCTCCTCCCACTATAAGGCGG
CTTGCATTACGGTGGCAGGAGTGATTGATAAGGGAAGGAATGAGCCACAGACCTGAGAGC
CTCGTCTTTGGCTTTTGCGGGTCTTTATTGGGAAACTCGCCCTCAAAAGAATTGAGCACC
ATGATATCCATGATTCTTGTCAAATCAACTGAGGGGAGATCGTTGTCACAGCTGATGTTG
GTGCAGCTTGAGGATGGCGAAGTGAGGAGATCCATGGTGGGCACTGGCAAAACGTTTTGC
GACTCATGGGTGTGTGCAAGTGTATAGATCTGCCTGCGGAAGTGAT
■■Homology search results ■■ -
sp_hit_id Q9CWR2
Definition sp|Q9CWR2|SMYD3_MOUSE SET and MYND domain-containing protein 3 OS=Mus musculus
Align length 106
Score (bit) 62.0
E-value 1.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919105|Adiantum capillus-veneris mRNA, clone:
YMU001_000121_C08.
(466 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9CWR2|SMYD3_MOUSE SET and MYND domain-containing protein 3 O... 62 1e-09
sp|Q9H7B4|SMYD3_HUMAN SET and MYND domain-containing protein 3 O... 59 1e-08
sp|O46040|MSTAA_DROME Protein msta, isoform A OS=Drosophila mela... 55 1e-07
sp|Q12529|SET6_YEAST Potential protein lysine methyltransferase ... 54 4e-07
sp|A5DQN2|SET5_PICGU Potential protein lysine methyltransferase ... 53 6e-07
sp|Q7XJS0|ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 O... 52 2e-06
sp|Q75BF1|SET5_ASHGO Potential protein lysine methyltransferase ... 50 4e-06
sp|Q3TYX3|SMYD5_MOUSE SET and MYND domain-containing protein 5 O... 50 5e-06
sp|O74467|SET5_SCHPO SET domain-containing protein 5 OS=Schizosa... 50 5e-06
sp|Q6BSV3|SET5_DEBHA Potential protein lysine methyltransferase ... 50 6e-06
sp|A7TPV3|SET5_VANPO Potential protein lysine methyltransferase ... 48 2e-05
sp|Q6GPQ4|SMYD5_XENLA SET and MYND domain-containing protein 5 O... 48 2e-05
sp|Q6GMV2|SMYD5_HUMAN SET and MYND domain-containing protein 5 O... 48 2e-05
sp|A3M0J3|SET5_PICST Potential protein lysine methyltransferase ... 48 2e-05
sp|P38890|SET5_YEAST Putative protein lysine methyltransferase S... 47 4e-05
sp|A6ZTB4|SET5_YEAS7 Potential protein lysine methyltransferase ... 47 4e-05
sp|Q5PP37|ATXR2_ARATH Histone-lysine N-methyltransferase ATXR2 O... 47 4e-05
sp|Q9NRG4|SMYD2_HUMAN SET and MYND domain-containing protein 2 O... 46 9e-05
sp|O94256|SET6_SCHPO SET domain and MYND-type zinc finger protei... 46 9e-05
sp|Q9FG08|ATXR4_ARATH Histone-lysine N-methyltransferase ATXR4 O... 46 9e-05
sp|Q5UNT8|YL678_MIMIV Putative SET domain-containing protein L67... 45 1e-04
sp|Q5A1M3|SET5_CANAL Potential protein lysine methyltransferase ... 45 2e-04
sp|Q5ZIZ2|SMYD5_CHICK SET and MYND domain-containing protein 5 O... 45 2e-04
sp|Q5R5X9|SMYD4_PONAB SET and MYND domain-containing protein 4 O... 44 3e-04
sp|Q7M6Z3|SMYD2_RAT SET and MYND domain-containing protein 2 OS=... 44 3e-04
sp|Q8R5A0|SMYD2_MOUSE SET and MYND domain-containing protein 2 O... 44 3e-04
sp|Q6CX91|SET5_KLULA Potential protein lysine methyltransferase ... 44 3e-04
sp|P83501|MSTAB_DROME Protein msta, isoform B OS=Drosophila mela... 43 6e-04
sp|Q8IYR2|SMYD4_HUMAN SET and MYND domain-containing protein 4 O... 43 8e-04
sp|Q6C9E7|SET5_YARLI Potential protein lysine methyltransferase ... 43 8e-04

>sp|Q9CWR2|SMYD3_MOUSE SET and MYND domain-containing protein 3
OS=Mus musculus GN=Smyd3 PE=2 SV=1
Length = 428

Score = 62.0 bits (149), Expect = 1e-09
Identities = 39/106 (36%), Positives = 57/106 (53%)
Frame = -3

Query: 335 PSVDLTRIMDIMVLNSFEGEFPNKDPQKPKTRLSGLWLIPSLINHSCHRNASRLIVGGAM 156
PS DL ++ NSF N + Q+ GL+ SL+NHSC N S + G +
Sbjct: 167 PSFDLFEAFAKVICNSFT--ICNAEMQEVGV---GLYPSMSLLNHSCDPNCSIVFNGPHL 221

Query: 155 VIHAAAEIRKGEEITITYVDILALLQARQKAFQDMRFGFSCICKRC 18
++ A EI GEE+TI Y+D+L + R+K +D ++ F C C RC
Sbjct: 222 LLRAVREIEAGEELTICYLDMLMTSEERRKQLRD-QYCFECDCIRC 266


>sp|Q9H7B4|SMYD3_HUMAN SET and MYND domain-containing protein 3
OS=Homo sapiens GN=SMYD3 PE=1 SV=4
Length = 428

Score = 58.9 bits (141), Expect = 1e-08
Identities = 37/106 (34%), Positives = 57/106 (53%)
Frame = -3

Query: 335 PSVDLTRIMDIMVLNSFEGEFPNKDPQKPKTRLSGLWLIPSLINHSCHRNASRLIVGGAM 156
P+ DL ++ NSF N + Q+ GL+ SL+NHSC N S + G +
Sbjct: 167 PAFDLFEAFAKVICNSFT--ICNAEMQEVGV---GLYPSISLLNHSCDPNCSIVFNGPHL 221

Query: 155 VIHAAAEIRKGEEITITYVDILALLQARQKAFQDMRFGFSCICKRC 18
++ A +I GEE+TI Y+D+L + R+K +D ++ F C C RC
Sbjct: 222 LLRAVRDIEVGEELTICYLDMLMTSEERRKQLRD-QYCFECDCFRC 266


>sp|O46040|MSTAA_DROME Protein msta, isoform A OS=Drosophila
melanogaster GN=msta PE=2 SV=3
Length = 462

Score = 55.5 bits (132), Expect = 1e-07
Identities = 40/118 (33%), Positives = 58/118 (49%), Gaps = 7/118 (5%)
Frame = -3

Query: 350 CDNDLPSVD------LTRIMDIMVLNSFEGEFPNKDPQKPKTRLSGLWLIPSLINHSCHR 189
C + P+ D L RI+ ++ N+FE + + T L GL+ + +++NH C
Sbjct: 200 CFRNFPTTDRVFMDQLFRIVGVLNTNAFEAPCRSGGHE---TLLRGLFPLTAIMNHECTP 256

Query: 188 NASRLIVGGAM-VIHAAAEIRKGEEITITYVDILALLQARQKAFQDMRFGFSCICKRC 18
NAS G + V+ AA +I KG EIT TY IL + F M F+C C RC
Sbjct: 257 NASHYFENGRLAVVRAARDIPKGGEITTTYTKIL-WGNLTRNIFLKMTKHFACDCVRC 313


>sp|Q12529|SET6_YEAST Potential protein lysine methyltransferase
SET6 OS=Saccharomyces cerevisiae GN=SET6 PE=3 SV=1
Length = 373

Score = 53.5 bits (127), Expect = 4e-07
Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
Frame = -3

Query: 233 GLWLIP--SLINHSCHRNASRLIVGGAMVIHAAAEIRKGEEITITYVDILALLQARQKAF 60
G W+ P S NHSC+ N ++ G +M+ +I+K E+I I Y +L L +++AF
Sbjct: 292 GYWVFPEASYFNHSCNPNITKYRKGNSMLFTMNRDIKKDEQICIDYSGVLDLPTVKRRAF 351

Query: 59 QDMRFGFSCICKRCVLE 9
+ F C C+RC E
Sbjct: 352 LADSWFFDCACERCKSE 368


>sp|A5DQN2|SET5_PICGU Potential protein lysine methyltransferase
SET5 OS=Pichia guilliermondii GN=SET5 PE=3 SV=2
Length = 483

Score = 53.1 bits (126), Expect = 6e-07
Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 4/77 (5%)
Frame = -3

Query: 236 SGLWLIPSLINHSCHRN----ASRLIVGGAMVIHAAAEIRKGEEITITYVDILALLQARQ 69
S ++L S +NHSCH N AS G + + AA +I+ GEE+T +YV+ L RQ
Sbjct: 340 SCIFLTQSHLNHSCHPNTDVQASTASRTGPLKVFAARDIKAGEELTTSYVNPSHTLHQRQ 399

Query: 68 KAFQDMRFGFSCICKRC 18
+ + + +GF C C+RC
Sbjct: 400 RELR-VNWGFICSCQRC 415


>sp|Q7XJS0|ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1
OS=Arabidopsis thaliana GN=ASHR1 PE=2 SV=2
Length = 480

Score = 51.6 bits (122), Expect = 2e-06
Identities = 35/106 (33%), Positives = 51/106 (48%)
Frame = -3

Query: 335 PSVDLTRIMDIMVLNSFEGEFPNKDPQKPKTRLSGLWLIPSLINHSCHRNASRLIVGGAM 156
PSVDL I + S +P+ GL+ + S+INHSC NA +
Sbjct: 172 PSVDLREIAENFSKFSCNAHSICDSELRPQG--IGLFPLVSIINHSCSPNAVLVFEEQMA 229

Query: 155 VIHAAAEIRKGEEITITYVDILALLQARQKAFQDMRFGFSCICKRC 18
V+ A I K EITI+Y++ RQK+ ++ ++ F C C RC
Sbjct: 230 VVRAMDNISKDSEITISYIETAGSTLTRQKSLKE-QYLFHCQCARC 274


>sp|Q75BF1|SET5_ASHGO Potential protein lysine methyltransferase
SET5 OS=Ashbya gossypii GN=SET5 PE=3 SV=1
Length = 488

Score = 50.4 bits (119), Expect = 4e-06
Identities = 25/76 (32%), Positives = 46/76 (60%)
Frame = -3

Query: 230 LWLIPSLINHSCHRNASRLIVGGAMVIHAAAEIRKGEEITITYVDILALLQARQKAFQDM 51
++++ S +NHSC N + G + ++A EI+ EE+T++YV+ L + R++ + +
Sbjct: 336 IYMLLSHLNHSCEPNIYYELEGHHINVYARKEIKSDEELTVSYVNPLHDVDLRRRELR-V 394

Query: 50 RFGFSCICKRCVLEQS 3
+GF C+C RC E S
Sbjct: 395 NWGFLCLCDRCKREIS 410


>sp|Q3TYX3|SMYD5_MOUSE SET and MYND domain-containing protein 5
OS=Mus musculus GN=Smyd5 PE=2 SV=2
Length = 416

Score = 50.1 bits (118), Expect = 5e-06
Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
Frame = -3

Query: 236 SGLWLIPSLINHSCHRNASRLIVGGAMVIHAAA--EIRKGEEITITYVDILALLQARQKA 63
SGL+++ S NHSC NA V+H A +I+ GEEI I+Y+D ++R
Sbjct: 304 SGLFVLQSCCNHSCVPNAETSFPENNFVLHVTALEDIKPGEEICISYLDCCQRERSRHSR 363

Query: 62 FQDMR--FGFSCICKRCVLE 9
+ +R + F+C C +C+ E
Sbjct: 364 HKILRENYLFNCSCPKCLAE 383


>sp|O74467|SET5_SCHPO SET domain-containing protein 5
OS=Schizosaccharomyces pombe GN=set5 PE=1 SV=1
Length = 319

Score = 50.1 bits (118), Expect = 5e-06
Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 5/81 (6%)
Frame = -3

Query: 233 GLWLIPSLINHSCHRNAS-----RLIVGGAMVIHAAAEIRKGEEITITYVDILALLQARQ 69
G++L+ S +NH C N RL + +HA +I GEEI TY+D+ RQ
Sbjct: 95 GMFLLGSRMNHDCSPNVKHTWNPRL---DQVTVHAVRDIEAGEEILTTYIDLHKSHTERQ 151

Query: 68 KAFQDMRFGFSCICKRCVLEQ 6
K + FGF C C C +E+
Sbjct: 152 KILLE-HFGFKCYCSVCSVEE 171


>sp|Q6BSV3|SET5_DEBHA Potential protein lysine methyltransferase
SET5 OS=Debaryomyces hansenii GN=SET5 PE=3 SV=2
Length = 493

Score = 49.7 bits (117), Expect = 6e-06
Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
Frame = -3

Query: 236 SGLWLIPSLINHSCHRNA----SRLIVGGAMVIHAAAEIRKGEEITITYVDILALLQARQ 69
S ++L S +NH+C N S + + + AA +IR GEE+T TYV+ +Q RQ
Sbjct: 351 SCIYLTQSHLNHNCDPNTNVETSTTVRTNGLKVFAARDIRAGEELTTTYVNPAYTVQQRQ 410

Query: 68 KAFQDMRFGFSCICKRC 18
+ + + +GF C C++C
Sbjct: 411 RELR-VNWGFMCGCQKC 426


tr_hit_id B0ZR18
Definition tr|B0ZR18|B0ZR18_PINTA SET domain-containing protein C (Fragment) OS=Pinus taeda
Align length 78
Score (bit) 88.6
E-value 1.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919105|Adiantum capillus-veneris mRNA, clone:
YMU001_000121_C08.
(466 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B0ZR18|B0ZR18_PINTA SET domain-containing protein C (Fragment... 89 1e-16
tr|A2XCZ3|A2XCZ3_ORYSI Putative uncharacterized protein OS=Oryza... 89 1e-16
tr|B0ZR42|B0ZR42_PINRA SET domain-containing protein C (Fragment... 88 2e-16
tr|B0ZR45|B0ZR45_PINSY SET domain-containing protein C (Fragment... 88 2e-16
tr|B0ZR33|B0ZR33_PINTA SET domain-containing protein C (Fragment... 88 2e-16
tr|B0ZR47|B0ZR47_PINEL SET domain-containing protein C (Fragment... 87 4e-16
tr|B0ZR46|B0ZR46_PINEL SET domain-containing protein C (Fragment... 87 4e-16
tr|B0ZR23|B0ZR23_PINTA SET domain-containing protein C (Fragment... 87 4e-16
tr|B0ZR20|B0ZR20_PINTA SET domain-containing protein C (Fragment... 87 4e-16
tr|B0ZR10|B0ZR10_PINTA SET domain-containing protein C (Fragment... 87 4e-16
tr|B4F9T1|B4F9T1_MAIZE Putative uncharacterized protein OS=Zea m... 87 5e-16
tr|B0ZR39|B0ZR39_PINTA SET domain-containing protein C (Fragment... 87 5e-16
tr|Q8S7V1|Q8S7V1_ORYSJ Os03g0168700 protein OS=Oryza sativa subs... 86 7e-16
tr|A3AEJ0|A3AEJ0_ORYSJ Putative uncharacterized protein OS=Oryza... 86 7e-16
tr|B0ZR19|B0ZR19_PINTA SET domain-containing protein C (Fragment... 86 9e-16
tr|B0ZR44|B0ZR44_PINSY SET domain-containing protein C (Fragment... 85 2e-15
tr|B0ZR26|B0ZR26_PINTA SET domain-containing protein C (Fragment... 85 2e-15
tr|B0ZR21|B0ZR21_PINTA SET domain-containing protein C (Fragment... 85 2e-15
tr|B0ZR12|B0ZR12_PINTA SET domain-containing protein C (Fragment... 85 2e-15
tr|A7QUQ3|A7QUQ3_VITVI Chromosome chr10 scaffold_179, whole geno... 82 2e-14
tr|A5BCK6|A5BCK6_VITVI Putative uncharacterized protein OS=Vitis... 81 2e-14
tr|Q9LQX6|Q9LQX6_ARATH T24P13.14 OS=Arabidopsis thaliana PE=4 SV=1 81 3e-14
tr|A9SV99|A9SV99_PHYPA Predicted protein OS=Physcomitrella paten... 78 2e-13
tr|A9TID7|A9TID7_PHYPA Predicted protein OS=Physcomitrella paten... 77 6e-13
tr|Q60D23|Q60D23_SOLDE TPR domain containing protein, putative O... 75 1e-12
tr|Q5NRN1|Q5NRN1_SOLDE TPR domain containing protein, putative O... 75 2e-12
tr|Q6F2D2|Q6F2D2_SOLDE Putative TPR domain containing protein, i... 74 3e-12
tr|Q2HHN2|Q2HHN2_CHAGB Putative uncharacterized protein OS=Chaet... 71 3e-11
tr|B2WL96|B2WL96_PYRTR Putative uncharacterized protein OS=Pyren... 71 3e-11
tr|B8CD92|B8CD92_THAPS Predicted protein OS=Thalassiosira pseudo... 68 3e-10

>tr|B0ZR18|B0ZR18_PINTA SET domain-containing protein C (Fragment)
OS=Pinus taeda GN=SET-C PE=4 SV=1
Length = 141

Score = 88.6 bits (218), Expect = 1e-16
Identities = 43/78 (55%), Positives = 55/78 (70%)
Frame = -3

Query: 236 SGLWLIPSLINHSCHRNASRLIVGGAMVIHAAAEIRKGEEITITYVDILALLQARQKAFQ 57
SGLWL+PS INHSC N+SRL +G AM IHA I++GEEIT Y DIL L RQ+ +
Sbjct: 11 SGLWLLPSFINHSCLPNSSRLEMGSAMFIHACKPIKRGEEITFPYFDILLPLPQRQRRCE 70

Query: 56 DMRFGFSCICKRCVLEQS 3
+ +GF C C+RC++E S
Sbjct: 71 N--WGFECKCRRCIVELS 86


>tr|A2XCZ3|A2XCZ3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10178 PE=4 SV=1
Length = 536

Score = 88.6 bits (218), Expect = 1e-16
Identities = 51/153 (33%), Positives = 82/153 (53%), Gaps = 4/153 (2%)
Frame = -3

Query: 449 IYTLAHTHESQNVLPVPTMDLLTSPSSSCTNISCDNDLPSVDLTRIMDIMVLNSF-EGEF 273
IYTL+ E ++ LP+P M + + + S+D+ +I+ ++ +N E
Sbjct: 237 IYTLSTGEEPEDELPIPDMAHFKQETEELDDGTAMAPKASLDVDKILKVLDVNCLTEDAA 296

Query: 272 PNKDPQKPKTRLS---GLWLIPSLINHSCHRNASRLIVGGAMVIHAAAEIRKGEEITITY 102
P+ + ++ GLW++P+ INHSCH NA R VG ++HA+ +I+ GEEIT Y
Sbjct: 297 PSANLLGSNGVVNCGVGLWILPAFINHSCHPNARRTHVGDHAIVHASRDIKAGEEITFAY 356

Query: 101 VDILALLQARQKAFQDMRFGFSCICKRCVLEQS 3
D+L R++A + +GF C C RC E S
Sbjct: 357 FDVLTPASKRREAAR--AWGFECQCDRCRFEAS 387


>tr|B0ZR42|B0ZR42_PINRA SET domain-containing protein C (Fragment)
OS=Pinus radiata GN=SET-C PE=4 SV=1
Length = 141

Score = 88.2 bits (217), Expect = 2e-16
Identities = 44/78 (56%), Positives = 54/78 (69%)
Frame = -3

Query: 236 SGLWLIPSLINHSCHRNASRLIVGGAMVIHAAAEIRKGEEITITYVDILALLQARQKAFQ 57
SGLWL+PS INHSC N+SRL +G AM IHA I++GEEIT Y DIL L RQ +
Sbjct: 11 SGLWLLPSFINHSCLPNSSRLEMGSAMFIHACKPIKRGEEITFPYFDILLPLPQRQGRCE 70

Query: 56 DMRFGFSCICKRCVLEQS 3
+ +GF C C+RC+LE S
Sbjct: 71 N--WGFECKCRRCILELS 86


>tr|B0ZR45|B0ZR45_PINSY SET domain-containing protein C (Fragment)
OS=Pinus sylvestris GN=SET-C PE=4 SV=1
Length = 141

Score = 87.8 bits (216), Expect = 2e-16
Identities = 44/78 (56%), Positives = 53/78 (67%)
Frame = -3

Query: 236 SGLWLIPSLINHSCHRNASRLIVGGAMVIHAAAEIRKGEEITITYVDILALLQARQKAFQ 57
SGLWL+PS INHSC N+SRL +G AM IHA I++GEEIT Y DIL L RQ +
Sbjct: 11 SGLWLLPSFINHSCLPNSSRLEMGSAMFIHACKPIKRGEEITFPYFDILLPLPQRQ--VR 68

Query: 56 DMRFGFSCICKRCVLEQS 3
+GF C C+RC+LE S
Sbjct: 69 GENWGFECQCRRCILELS 86


>tr|B0ZR33|B0ZR33_PINTA SET domain-containing protein C (Fragment)
OS=Pinus taeda GN=SET-C PE=4 SV=1
Length = 141

Score = 87.8 bits (216), Expect = 2e-16
Identities = 43/78 (55%), Positives = 55/78 (70%)
Frame = -3

Query: 236 SGLWLIPSLINHSCHRNASRLIVGGAMVIHAAAEIRKGEEITITYVDILALLQARQKAFQ 57
SGLWL+PS+INHSC N+SRL +G AM IHA I++GEEIT Y DIL L RQ +
Sbjct: 11 SGLWLLPSIINHSCLPNSSRLEMGSAMFIHACKPIKRGEEITFPYFDILLPLPQRQGRCE 70

Query: 56 DMRFGFSCICKRCVLEQS 3
+ +GF C C+RC++E S
Sbjct: 71 N--WGFECKCRRCIVELS 86


>tr|B0ZR47|B0ZR47_PINEL SET domain-containing protein C (Fragment)
OS=Pinus elliottii GN=SET-C PE=4 SV=1
Length = 141

Score = 87.0 bits (214), Expect = 4e-16
Identities = 43/78 (55%), Positives = 54/78 (69%)
Frame = -3

Query: 236 SGLWLIPSLINHSCHRNASRLIVGGAMVIHAAAEIRKGEEITITYVDILALLQARQKAFQ 57
SGLWL+PS INHSC N+SRL +G AM IHA I++GEEIT Y DIL L RQ +
Sbjct: 11 SGLWLLPSFINHSCLPNSSRLEMGSAMFIHACKPIKRGEEITFPYFDILLPLPQRQGRCE 70

Query: 56 DMRFGFSCICKRCVLEQS 3
+ +GF C C+RC++E S
Sbjct: 71 N--WGFECKCRRCIVELS 86


>tr|B0ZR46|B0ZR46_PINEL SET domain-containing protein C (Fragment)
OS=Pinus elliottii GN=SET-C PE=4 SV=1
Length = 141

Score = 87.0 bits (214), Expect = 4e-16
Identities = 43/78 (55%), Positives = 54/78 (69%)
Frame = -3

Query: 236 SGLWLIPSLINHSCHRNASRLIVGGAMVIHAAAEIRKGEEITITYVDILALLQARQKAFQ 57
SGLWL+PS INHSC N+SRL +G AM IHA I++GEEIT Y DIL L RQ +
Sbjct: 11 SGLWLLPSFINHSCLPNSSRLEMGSAMFIHACKPIKRGEEITFPYFDILLPLPQRQGRCE 70

Query: 56 DMRFGFSCICKRCVLEQS 3
+ +GF C C+RC++E S
Sbjct: 71 N--WGFECKCRRCIVELS 86


>tr|B0ZR23|B0ZR23_PINTA SET domain-containing protein C (Fragment)
OS=Pinus taeda GN=SET-C PE=4 SV=1
Length = 141

Score = 87.0 bits (214), Expect = 4e-16
Identities = 43/78 (55%), Positives = 54/78 (69%)
Frame = -3

Query: 236 SGLWLIPSLINHSCHRNASRLIVGGAMVIHAAAEIRKGEEITITYVDILALLQARQKAFQ 57
SGLWL+PS INHSC N+SRL +G AM IHA I++GEEIT Y DIL L RQ +
Sbjct: 11 SGLWLLPSFINHSCLPNSSRLEMGSAMFIHACKPIKRGEEITFPYFDILLPLPQRQGRCE 70

Query: 56 DMRFGFSCICKRCVLEQS 3
+ +GF C C+RC++E S
Sbjct: 71 N--WGFECKCRRCIVELS 86


>tr|B0ZR20|B0ZR20_PINTA SET domain-containing protein C (Fragment)
OS=Pinus taeda GN=SET-C PE=4 SV=1
Length = 141

Score = 87.0 bits (214), Expect = 4e-16
Identities = 43/78 (55%), Positives = 54/78 (69%)
Frame = -3

Query: 236 SGLWLIPSLINHSCHRNASRLIVGGAMVIHAAAEIRKGEEITITYVDILALLQARQKAFQ 57
SGLWL+PS INHSC N+SRL +G AM IHA I++GEEIT Y DIL L RQ +
Sbjct: 11 SGLWLLPSFINHSCLPNSSRLEMGSAMFIHACKPIKRGEEITFPYFDILLPLPQRQGRCE 70

Query: 56 DMRFGFSCICKRCVLEQS 3
+ +GF C C+RC++E S
Sbjct: 71 N--WGFECKCRRCIVELS 86


>tr|B0ZR10|B0ZR10_PINTA SET domain-containing protein C (Fragment)
OS=Pinus taeda GN=SET-C PE=4 SV=1
Length = 141

Score = 87.0 bits (214), Expect = 4e-16
Identities = 43/78 (55%), Positives = 54/78 (69%)
Frame = -3

Query: 236 SGLWLIPSLINHSCHRNASRLIVGGAMVIHAAAEIRKGEEITITYVDILALLQARQKAFQ 57
SGLWL+PS INHSC N+SRL +G AM IHA I++GEEIT Y DIL L RQ +
Sbjct: 11 SGLWLLPSFINHSCLPNSSRLEMGSAMFIHACKPIKRGEEITFPYFDILLPLPQRQGRCE 70

Query: 56 DMRFGFSCICKRCVLEQS 3
+ +GF C C+RC++E S
Sbjct: 71 N--WGFECKCRRCIVELS 86