BP919168
Clone id YMU001_000122_A05
Library
Length 495
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000122_A05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTTTTTTCAATCAAAAGACTATGTTCCATATAGCTTCCACCAAATTCTCCAAGTGG
ATCACCAATTAACATTCGAAATTGTTGGGTGATGATACTTGTGCACACTGAAGACCCTTG
CAAATAAGAGAAGGTTCCATCATTTCCCAATATACACTGGCTCACAAGCAGCTAAACCTG
CTCCAGTCCATCCCTTCCACTGCAAGAGGTCCATGCAAATATCAGACTACCTTGCTTTCT
TCATGCCACATACGATAATACGACTGCAACCTGCATCGATACAAGTGGCTAGCTCATGCT
GGTTCTAAGCAAGCTGGAATAAGACAACTAGCCACCCCCAAACCTTCCCCTTCTTAGCAC
ATGCAGAAGGTTCTGACAGAAAATAACTGTGGGCGAAGGAAGACGTTTCTGATGCTTGAC
CACCAAGACAGATATCTGGCTTTATCAAACATTGCATTCCATTATCTTTCCTTCCTTCTC
ACAACTCAAGCTTAA
■■Homology search results ■■ -
sp_hit_id Q859W7
Definition sp|Q859W7|YCF2_ANTFO Protein ycf2 OS=Anthoceros formosae
Align length 36
Score (bit) 32.7
E-value 0.88
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919168|Adiantum capillus-veneris mRNA, clone:
YMU001_000122_A05.
(484 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q859W7|YCF2_ANTFO Protein ycf2 OS=Anthoceros formosae GN=ycf2... 33 0.88
sp|P20622|NIFK_METTL Nitrogenase molybdenum-iron protein beta ch... 30 7.5

>sp|Q859W7|YCF2_ANTFO Protein ycf2 OS=Anthoceros formosae GN=ycf2 PE=2
SV=1
Length = 2392

Score = 32.7 bits (73), Expect = 0.88
Identities = 14/36 (38%), Positives = 24/36 (66%)
Frame = +2

Query: 353 QKVLTENNCGRRKTFLMLDHQDRYLALSNIAFHYLS 460
Q L EN+ + F +L+H++R++ L+N +FHY S
Sbjct: 2307 QSWLIENSREKLSRFDLLNHRERWIKLNNKSFHYFS 2342


>sp|P20622|NIFK_METTL Nitrogenase molybdenum-iron protein beta chain
(Fragment) OS=Methanococcus thermolithotrophicus GN=nifK
PE=3 SV=1
Length = 79

Score = 29.6 bits (65), Expect = 7.5
Identities = 13/43 (30%), Positives = 22/43 (51%)
Frame = -1

Query: 139 LGNDGTFSYLQGSSVCTSIITQQFRMLIGDPLGEFGGSYMEHS 11
+G GT ++QGS CT+ + F +P+ S+ EH+
Sbjct: 36 VGVKGTIPFVQGSQGCTTYVRYAFNRHFREPVSIATASFHEHA 78


tr_hit_id Q239Z1
Definition tr|Q239Z1|Q239Z1_TETTH Putative uncharacterized protein OS=Tetrahymena thermophila SB210
Align length 79
Score (bit) 35.0
E-value 1.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919168|Adiantum capillus-veneris mRNA, clone:
YMU001_000122_A05.
(484 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q239Z1|Q239Z1_TETTH Putative uncharacterized protein OS=Tetra... 35 1.8
tr|B6NG83|B6NG83_BRAFL Putative uncharacterized protein (Fragmen... 33 9.2

>tr|Q239Z1|Q239Z1_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00885880 PE=4
SV=1
Length = 2396

Score = 35.0 bits (79), Expect = 1.8
Identities = 22/79 (27%), Positives = 31/79 (39%)
Frame = -3

Query: 455 DNGMQCLIKPDICLGGQASETSSFAHSYFLSEPSACAKKGKVWGWLVVLFQLA*NQHELA 276
DN + C+ PD C G + Y C GKVW + Q +E
Sbjct: 2225 DNIVSCVYNPDNCQGESTDSIQNCRQGYIGPLCETCDLNGKVWKQKYMNKQ----PYECI 2280

Query: 275 TCIDAGCSRIIVCGMKKAR 219
CID+ I+ G++ AR
Sbjct: 2281 PCIDSSGCLYIIFGVRAAR 2299


>tr|B6NG83|B6NG83_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_228627 PE=4 SV=1
Length = 492

Score = 32.7 bits (73), Expect = 9.2
Identities = 14/28 (50%), Positives = 18/28 (64%)
Frame = +3

Query: 378 VGEGRRF*CLTTKTDIWLYQTLHSIIFP 461
VGE + +KTD+WLYQT H + FP
Sbjct: 202 VGEKETIQSVVSKTDLWLYQTDHVLDFP 229