BP919175
Clone id YMU001_000122_B02
Library
Length 508
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000122_B02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GAAGAGCACAATGATCCACAACCACTACAGTAACAAGTAAAATCTGGCTACAAACACCAC
AAAAAGGGAGACCCTTCTTCCCTTTCGCCAAGGGCGGCACACCCACTTGCTTGCAGATGA
GCAGCAGTTGTTGCATCAAAACTGCGGCTTTTGACCAATTCCACATGCTTTGTTTACCAA
AATGTCTAATATTTCACTACATATTCAAAACAAATATATCTTCCACTACTGTATATGAGA
GTAAACCTCGTACCAATTGAAGATCCCAGCGAACAATGGATCAATGCCAAACCATCGCTA
ACGCTTCTTCAAATACCCAATATAGCAGACTGCAAAGAGCTCCAACCCGTTGATACAACA
AGAACACCGAAGCTAAAACTACACTAATTCAATGCTACTGTATGTCAGTAGGCCTACGGC
CCTCTATACTGAGGATCCGCTGTAGGGCCCCGATATTGAGGAGGGAGAGGCGTACTTGGT
CTTCCTTGTGCGCCTGCAAAATTGTACC
■■Homology search results ■■ -
sp_hit_id Q8CFE5
Definition sp|Q8CFE5|BTBD7_MOUSE BTB/POZ domain-containing protein 7 OS=Mus musculus
Align length 38
Score (bit) 32.3
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919175|Adiantum capillus-veneris mRNA, clone:
YMU001_000122_B02.
(508 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8CFE5|BTBD7_MOUSE BTB/POZ domain-containing protein 7 OS=Mus... 32 1.3
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculu... 32 2.2
sp|Q10163|RSMB_SCHPO Small nuclear ribonucleoprotein-associated ... 31 2.9
sp|P55053|FABP5_RAT Fatty acid-binding protein, epidermal OS=Rat... 30 4.9
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norveg... 30 6.5
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculu... 30 6.5
sp|O26742|PUR1_METTH Amidophosphoribosyltransferase OS=Methanoba... 30 6.6
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapien... 30 8.4

>sp|Q8CFE5|BTBD7_MOUSE BTB/POZ domain-containing protein 7 OS=Mus
musculus GN=Btbd7 PE=2 SV=1
Length = 1130

Score = 32.3 bits (72), Expect = 1.3
Identities = 16/38 (42%), Positives = 21/38 (55%)
Frame = -3

Query: 506 YNFAGAQGRPSTPLPPQYRGPTADPQYRGP*AY*HTVA 393
Y+F+ A RPSTP P ++ A +Y GP Y H A
Sbjct: 942 YDFSNAACRPSTPAPGRHSPSPAHGRYFGPDLYSHNKA 979


>sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus
GN=Col7a1 PE=2 SV=3
Length = 2944

Score = 31.6 bits (70), Expect = 2.2
Identities = 14/28 (50%), Positives = 15/28 (53%)
Frame = -3

Query: 500 FAGAQGRPSTPLPPQYRGPTADPQYRGP 417
F G +G P PP RGP DP RGP
Sbjct: 1361 FPGKKGDPGPSGPPGSRGPVGDPGPRGP 1388


>sp|Q10163|RSMB_SCHPO Small nuclear ribonucleoprotein-associated
protein B OS=Schizosaccharomyces pombe GN=smb1 PE=2 SV=1
Length = 147

Score = 31.2 bits (69), Expect = 2.9
Identities = 15/33 (45%), Positives = 19/33 (57%)
Frame = +3

Query: 147 AFDQFHMLCLPKCLIFHYIFKTNISSTTVYESK 245
AFD F L L C + +I K N+ S +VYE K
Sbjct: 30 AFDGFMNLVLSDCQEYRHIKKQNVPSNSVYEEK 62


>sp|P55053|FABP5_RAT Fatty acid-binding protein, epidermal OS=Rattus
norvegicus GN=Fabp5 PE=1 SV=3
Length = 135

Score = 30.4 bits (67), Expect = 4.9
Identities = 15/46 (32%), Positives = 24/46 (52%)
Frame = -3

Query: 383 CSFSFGVLVVSTGWSSLQSAILGI*RSVSDGLALIHCSLGSSIGTR 246
C+F+ G LV W +S I R + DG ++ C + ++I TR
Sbjct: 87 CTFTDGALVQHQKWEGKESTIT---RKLKDGKMVVECVMNNAICTR 129


>sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus
norvegicus GN=Col3a1 PE=2 SV=3
Length = 1463

Score = 30.0 bits (66), Expect = 6.5
Identities = 11/26 (42%), Positives = 15/26 (57%)
Frame = -3

Query: 494 GAQGRPSTPLPPQYRGPTADPQYRGP 417
G+ G P +P P Y+GP +P GP
Sbjct: 185 GSSGHPGSPGSPGYQGPPGEPGQAGP 210


>sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus
GN=Col3a1 PE=2 SV=4
Length = 1464

Score = 30.0 bits (66), Expect = 6.5
Identities = 11/26 (42%), Positives = 15/26 (57%)
Frame = -3

Query: 494 GAQGRPSTPLPPQYRGPTADPQYRGP 417
G+ G P +P P Y+GP +P GP
Sbjct: 185 GSSGHPGSPGSPGYQGPPGEPGQAGP 210


>sp|O26742|PUR1_METTH Amidophosphoribosyltransferase
OS=Methanobacterium thermoautotrophicum GN=purF PE=3
SV=1
Length = 474

Score = 30.0 bits (66), Expect = 6.6
Identities = 19/65 (29%), Positives = 34/65 (52%)
Frame = -1

Query: 205 NM**NIRHFGKQSMWNWSKAAVLMQQLLLICKQVGVPPLAKGKKGLPFCGVCSQILLVTV 26
NM +I+ +Q + ++S +L Q L ++ VG+ PLA +KG V S+ + V
Sbjct: 156 NMIYSIKRVSEQLVGSYSLVVLLNQDLYVVRDPVGIKPLAFARKGSTQI-VASETVAFDV 214

Query: 25 VVVDH 11
+ +H
Sbjct: 215 IGAEH 219


>sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens
GN=COL3A1 PE=1 SV=4
Length = 1466

Score = 29.6 bits (65), Expect = 8.4
Identities = 11/26 (42%), Positives = 14/26 (53%)
Frame = -3

Query: 494 GAQGRPSTPLPPQYRGPTADPQYRGP 417
G G P +P P Y+GP +P GP
Sbjct: 186 GTSGHPGSPGSPGYQGPPGEPGQAGP 211


tr_hit_id A5KZ45
Definition tr|A5KZ45|A5KZ45_9GAMM Putative uncharacterized protein OS=Vibrionales bacterium SWAT-3
Align length 56
Score (bit) 33.5
E-value 6.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919175|Adiantum capillus-veneris mRNA, clone:
YMU001_000122_B02.
(508 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5KZ45|A5KZ45_9GAMM Putative uncharacterized protein OS=Vibri... 33 6.1
tr|Q2Q1J8|Q2Q1J8_9NEOP NADH-ubiquinone oxidoreductase chain 6 OS... 33 6.1
tr|B0U802|B0U802_METS4 CTP synthase OS=Methylobacterium sp. (str... 33 7.8
tr|B8IP92|B8IP92_METNO CTP synthase OS=Methylobacterium nodulans... 33 7.8

>tr|A5KZ45|A5KZ45_9GAMM Putative uncharacterized protein
OS=Vibrionales bacterium SWAT-3 GN=VSWAT3_19681 PE=4
SV=1
Length = 586

Score = 33.5 bits (75), Expect = 6.1
Identities = 16/56 (28%), Positives = 33/56 (58%), Gaps = 2/56 (3%)
Frame = -1

Query: 382 VVLASVFLLYQRVGALCSLLY--WVFEEALAMVWH*SIVRWDLQLVRGLLSYTVVE 221
V+ A+++LL++ C++LY ++F ALA+ W ++R L L +Y +++
Sbjct: 359 VIPATLYLLFKNKNDHCTILYLIFIFNLALALFWQIRVMRLCFVLAAPLQAYVIIQ 414


>tr|Q2Q1J8|Q2Q1J8_9NEOP NADH-ubiquinone oxidoreductase chain 6
OS=Tamolanica tamolana GN=ND6 PE=3 SV=1
Length = 167

Score = 33.5 bits (75), Expect = 6.1
Identities = 21/57 (36%), Positives = 30/57 (52%)
Frame = +1

Query: 151 LTNSTCFVYQNV*YFTTYSKQIYLPLLYMRVNLVPIEDPSEQWINAKPSLTLLQIPN 321
L ++ F Y N F K I+LPL++M + + PS + N + SLTL IPN
Sbjct: 71 LASNEMFFYSNKILF----KIIFLPLIFMLIYFIYPYYPSNMYENMENSLTLSLIPN 123


>tr|B0U802|B0U802_METS4 CTP synthase OS=Methylobacterium sp. (strain
4-46) GN=M446_5402 PE=3 SV=1
Length = 542

Score = 33.1 bits (74), Expect = 7.8
Identities = 14/29 (48%), Positives = 18/29 (62%)
Frame = +3

Query: 405 SVGLRPSILRIRCRAPILRRERRTWSSLC 491
S+G++P IL RC PI R ERR + C
Sbjct: 199 SIGIQPDILLCRCDRPIPREERRKLAQFC 227


>tr|B8IP92|B8IP92_METNO CTP synthase OS=Methylobacterium nodulans
ORS 2060 GN=Mnod_5568 PE=3 SV=1
Length = 542

Score = 33.1 bits (74), Expect = 7.8
Identities = 14/29 (48%), Positives = 18/29 (62%)
Frame = +3

Query: 405 SVGLRPSILRIRCRAPILRRERRTWSSLC 491
S+G++P IL RC PI R ERR + C
Sbjct: 199 SIGIQPDILLCRCDRPIPREERRKLAQFC 227