BP919180
Clone id YMU001_000122_B07
Library
Length 406
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000122_B07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTTTTTTTTTTTTTTTGTCAAAATGTCTGTCGCCAGGACTCTTATTCCCATTTACAGAT
AGATTCTTTGAACCTACCAGCAACATACCTGGATGAATATAAATGGAAAAGCACCAGAAG
CATCTATGTGATGCCTCGCTCATCAACATTCGCATGACCGCTCACGGCATGCTGCCCTTC
CCTCAAAACTCAAAACTTCAGCAAATGCGTCTGTATGCACATGGGACAAGCTAGAGGGAA
AAGGTTTAGTACATAAGCGCCTCTTCTGCACTTGGCTTCTATTGCTACAAGTATGAGCAA
CCAAATACCTAAAAAAGACTCTTGTGTTCTTGCTTGCGACTGTATATGCCCTCTACTTTG
CCTTCAAAGTTTCACACACTGCCATTAATCTTAATGGCAACCTGTG
■■Homology search results ■■ -
sp_hit_id A1DB13
Definition sp|A1DB13|CFT1_NEOFI Protein cft1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL 181)
Align length 50
Score (bit) 30.0
E-value 3.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919180|Adiantum capillus-veneris mRNA, clone:
YMU001_000122_B07.
(389 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A1DB13|CFT1_NEOFI Protein cft1 OS=Neosartorya fischeri (strai... 30 3.8
sp|Q4WCL1|CFT1_ASPFU Protein cft1 OS=Aspergillus fumigatus GN=cf... 29 6.4
sp|A2RFE5|EZRA_STRPG Septation ring formation regulator ezrA OS=... 29 8.4
sp|Q8P1M3|EZRA_STRP8 Septation ring formation regulator ezrA OS=... 29 8.4
sp|Q5XD04|EZRA_STRP6 Septation ring formation regulator ezrA OS=... 29 8.4

>sp|A1DB13|CFT1_NEOFI Protein cft1 OS=Neosartorya fischeri (strain
ATCC 1020 / DSM 3700 / NRRL 181) GN=cft1 PE=3 SV=1
Length = 1400

Score = 30.0 bits (66), Expect = 3.8
Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
Frame = +3

Query: 21 DSYS-HLQIDSLNLPATYLDEYKWKSTRSIYVMPRSSTFA*PLTACCPSL 167
D Y HL D N + ++ R++Y P +S+F PLTA PS+
Sbjct: 182 DDYEFHLHQDDFNQVSDHVGNDLKSKDRTVYQTPYASSFVLPLTALDPSI 231


>sp|Q4WCL1|CFT1_ASPFU Protein cft1 OS=Aspergillus fumigatus GN=cft1
PE=3 SV=2
Length = 1401

Score = 29.3 bits (64), Expect = 6.4
Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
Frame = +3

Query: 21 DSYS-HLQIDSLNLPATYLDEYKWKSTRSIYVMPRSSTFA*PLTACCPSL 167
D Y HL D LN + ++ ++Y P +S+F PLTA PS+
Sbjct: 182 DDYEFHLHQDDLNQVSDHVGNGLKSKDSTVYQTPYASSFVLPLTALDPSI 231


>sp|A2RFE5|EZRA_STRPG Septation ring formation regulator ezrA
OS=Streptococcus pyogenes serotype M5 (strain Manfredo)
GN=ezrA PE=3 SV=1
Length = 574

Score = 28.9 bits (63), Expect = 8.4
Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 2/65 (3%)
Frame = -1

Query: 374 RLMAVCETLKAK*RAYTVASKNTRVFFRYLVAHTCSNRSQVQKR--RLCTKPFPSSLSHV 201
R+ ++ E + + AY VA+KN+++ RYL AH N Q++ RL K S +
Sbjct: 293 RIDSLYEVFEREIAAYKVAAKNSKMLPRYL-AHVKRNNEQLKNEIARLSRKYILSETESL 351

Query: 200 HTDAF 186
AF
Sbjct: 352 TVKAF 356


>sp|Q8P1M3|EZRA_STRP8 Septation ring formation regulator ezrA
OS=Streptococcus pyogenes serotype M18 GN=ezrA PE=3 SV=1
Length = 574

Score = 28.9 bits (63), Expect = 8.4
Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 2/65 (3%)
Frame = -1

Query: 374 RLMAVCETLKAK*RAYTVASKNTRVFFRYLVAHTCSNRSQVQKR--RLCTKPFPSSLSHV 201
R+ ++ E + + AY VA+KN+++ RYL AH N Q++ RL K S +
Sbjct: 293 RIDSLYEVFEREIAAYKVAAKNSKMLPRYL-AHVKRNNEQLKNEIARLSRKYILSETESL 351

Query: 200 HTDAF 186
AF
Sbjct: 352 TVKAF 356


>sp|Q5XD04|EZRA_STRP6 Septation ring formation regulator ezrA
OS=Streptococcus pyogenes serotype M6 GN=ezrA PE=3 SV=1
Length = 574

Score = 28.9 bits (63), Expect = 8.4
Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 2/65 (3%)
Frame = -1

Query: 374 RLMAVCETLKAK*RAYTVASKNTRVFFRYLVAHTCSNRSQVQKR--RLCTKPFPSSLSHV 201
R+ ++ E + + AY VA+KN+++ RYL AH N Q++ RL K S +
Sbjct: 293 RIDSLYEVFEREIAAYKVAAKNSKMLPRYL-AHVKRNNEQLKNEIARLSRKYILSETESL 351

Query: 200 HTDAF 186
AF
Sbjct: 352 TVKAF 356


tr_hit_id Q4HKM8
Definition tr|Q4HKM8|Q4HKM8_CAMLA Probable periplasmic protein Cj0515 OS=Campylobacter lari RM2100
Align length 30
Score (bit) 35.0
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919180|Adiantum capillus-veneris mRNA, clone:
YMU001_000122_B07.
(389 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4HKM8|Q4HKM8_CAMLA Probable periplasmic protein Cj0515 OS=Ca... 35 1.9
tr|A1WEV4|A1WEV4_VEREI Putative lipoprotein signal peptide OS=Ve... 34 3.2
tr|Q831J9|Q831J9_ENTFA Putative uncharacterized protein OS=Enter... 33 9.3
tr|B7FXC7|B7FXC7_PHATR Predicted protein OS=Phaeodactylum tricor... 33 9.3

>tr|Q4HKM8|Q4HKM8_CAMLA Probable periplasmic protein Cj0515
OS=Campylobacter lari RM2100 GN=CLA1074 PE=4 SV=1
Length = 401

Score = 35.0 bits (79), Expect = 1.9
Identities = 13/30 (43%), Positives = 23/30 (76%)
Frame = +1

Query: 289 YLKKTLVFLLATVYALYFAFKVSHTAINLN 378
+ KKT+ ++L+ ++ALYF FK S+ A+ L+
Sbjct: 297 FYKKTIFWILSAIFALYFVFKKSYVALGLS 326


>tr|A1WEV4|A1WEV4_VEREI Putative lipoprotein signal peptide
OS=Verminephrobacter eiseniae (strain EF01-2)
GN=Veis_0371 PE=4 SV=1
Length = 146

Score = 34.3 bits (77), Expect = 3.2
Identities = 14/41 (34%), Positives = 23/41 (56%)
Frame = -1

Query: 290 YLVAHTCSNRSQVQKRRLCTKPFPSSLSHVHTDAFAEVLSF 168
Y+ C+ Q Q+R++CT P S + VH D A+ ++F
Sbjct: 95 YMFIAQCTPSGQAQQRQICTDPSGLSRAQVHRDTVAQAVAF 135


>tr|Q831J9|Q831J9_ENTFA Putative uncharacterized protein
OS=Enterococcus faecalis GN=EF_2507 PE=4 SV=1
Length = 443

Score = 32.7 bits (73), Expect = 9.3
Identities = 21/61 (34%), Positives = 29/61 (47%)
Frame = +1

Query: 160 LPSKLKTSANASVCTWDKLEGKGLVHKRLFCTWLLLLQV*ATKYLKKTLVFLLATVYALY 339
L L +N S+ + K EG+ + H L T LL + + K T + L VYALY
Sbjct: 103 LSGALLPPSNQSIRFFLKEEGQKISHSNLLTTVLLTAVLFGALFFKATEIGLALLVYALY 162

Query: 340 F 342
F
Sbjct: 163 F 163


>tr|B7FXC7|B7FXC7_PHATR Predicted protein OS=Phaeodactylum tricornutum
CCAP 1055/1 GN=PHATRDRAFT_45342 PE=4 SV=1
Length = 1366

Score = 32.7 bits (73), Expect = 9.3
Identities = 21/60 (35%), Positives = 28/60 (46%)
Frame = +1

Query: 127 QHSHDRSRHAALPSKLKTSANASVCTWDKLEGKGLVHKRLFCTWLLLLQV*ATKYLKKTL 306
QHS + ALP LK S A V W+K +G ++ K + W + Q A K K L
Sbjct: 1039 QHSKG---YTALPFSLKRSLRADVLLWNKQDGSRILAKNVDGAWAEVAQETAEKACHKKL 1095